KEGG   Bifidobacterium dentium Bd1: BDP_1786Help
Entry
BDP_1786          CDS       T01143                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K09157  uncharacterized protein
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BDP_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF711
Motif
Other DBs
NCBI-ProteinID: ADB10373
UniProt: D2Q608
Position
complement(2039743..2041107)
Genome map
AA seq 454 aa AA seqDB search
MLNIMEVHETNQMIEQEKLDVRTITMGISLLDCAADDVDTVCDNIYNKITTYAKDLVPTG
QAIERDYGIPIVNKRITVTPISLVGASSCKSSDDFVKIAHALDRAAKKVGVDLIGGYSAL
VSKSMTPAEEMLIRSLPKALSETDIVCSSVNVGSTKTGIDMNSVELLGHIIKDIAHATAD
NDSYGCVKFVAFCNAPDDNPFMAGGFHGVTEGDAVINVGVSGPGVVSRALDEAKGKDFEF
LCETIKRTAFKITRVGQLVAQEASRRLGVPFGIIDLSLAPTPAVGDSVGEVLEKIGLEQV
GAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSEDKNMIDAASNGCLKIEKLEAM
TCVCSVGLDMIAIPGDTTASTISGIIADEAAIGMVNQKTTAVRVIPVEGKGVGEMANFGG
LMGYAPIIPVNQTSCEAFVTRGGRIPAPIHSFKN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatatcatggaggtccacgagaccaaccagatgatcgagcaggagaagctcgac
gtgcgcaccatcaccatgggcatcagcctgctggattgcgcggccgatgacgtcgatacc
gtctgcgacaacatctacaacaaaatcaccacctatgccaaggatctcgtgccgaccggc
caggccatcgaacgcgattacggcatcccgatcgtcaacaagcgcatcaccgtcaccccg
atctcgctggtcggcgccagctcctgcaagagctccgacgacttcgtgaagatcgcgcac
gcgctcgaccgggcggccaagaaggtcggcgtcgatctgatcggcggctactccgcgctc
gtgtcgaagtccatgaccccggccgaggagatgctcatccgctccctgccgaaggcgctg
tccgaaaccgacatcgtatgctcgtccgtcaacgtgggctccaccaaaaccggtatcgac
atgaattccgtcgaactgctcggccacatcatcaaggacatcgcgcacgccaccgccgac
aacgattcctatggctgcgtcaaattcgtggcgttctgcaacgctccggacgacaatccg
ttcatggccggcggcttccatggcgtgaccgaaggcgatgcggtgatcaacgtcggcgtt
tccggtccgggcgtggtctcccgtgcgctcgacgaggccaagggcaaggatttcgaattc
ctgtgcgaaaccatcaagcgcaccgcgttcaagatcacgcgtgtcggccagctggtggcg
caggaggcgtcccgtcgactcggcgtgccgttcggcatcatcgacctgtcgctcgcgccg
actccggccgtgggcgattccgtcggtgaagtgctcgagaagatcggcttggagcaggtc
ggcgctccgggtaccactgcggcgctcgccatgctcaacgatcaggtgaagaagggcggc
atcatggcgtcctcctatgttggcggactgtccggcgcgttcattccggtttcggaagac
aagaacatgatcgatgcggcatccaacggctgcctgaagatcgagaagctcgaagccatg
acctgcgtatgctcggtcggccttgatatgatcgccattccgggtgataccaccgcttcg
acgatttccggcatcatcgccgacgaggccgccattggcatggtcaatcagaagaccacc
gccgtgcgcgtgattccggtcgaaggcaagggcgtcggtgagatggccaacttcggcgga
ctgatgggctacgcgccgatcatcccggtgaaccagacgtcttgcgaggctttcgtgacc
cgcggcggccgaattcccgcgccgatccactcgttcaagaactga

DBGET integrated database retrieval system