KEGG   Bifidobacterium dentium Bd1: BDP_1787Help
Entry
BDP_1787          CDS       T01143                                 

Definition
(GenBank) ACT domain-containing protein
  KO
K07166  ACT domain-containing protein
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BDP_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT_6 ACT ACT_4 ACT_7
Motif
Other DBs
NCBI-ProteinID: ADB10374
UniProt: D2Q609
Position
complement(2041130..2041402)
Genome map
AA seq 90 aa AA seqDB search
MNKAIITVVGQDTVGIIARVCTYLSEHQVNVLDISQTIIDGFFNMMMIVDYSNADKEFGE
VVDDLEKLGDEIGVRIRCQREEIFTKMHRV
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcaatcatcaccgtcgtcggtcaggacactgtcggcatcatcgcacgcgtc
tgcacctatctgtccgaacatcaggtcaacgtgctcgatatctctcagaccatcatcgac
ggtttcttcaacatgatgatgattgtcgactattccaatgccgacaaggaattcggcgag
gtcgtggacgacctcgaaaagctcggcgacgagatcggcgtgcgcatccgctgccagcgc
gaagagatcttcaccaagatgcaccgcgtctga

DBGET integrated database retrieval system