KEGG   Bifidobacterium dentium Bd1: BDP_1805Help
Entry
BDP_1805          CDS       T01143                                 

Gene name
leuB
Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00290  Valine, leucine and isoleucine biosynthesis
bde00660  C5-Branched dibasic acid metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01210  2-Oxocarboxylic acid metabolism
bde01230  Biosynthesis of amino acids
Module
bde_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    BDP_1805 (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BDP_1805 (leuB)
Enzymes [BR:bde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     BDP_1805 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_lig_CPD
Motif
Other DBs
NCBI-ProteinID: ADB10391
UniProt: D2Q626
Position
complement(2060802..2061842)
Genome map
AA seq 346 aa AA seqDB search
MSETTKKYTIAVIPGDGIGKEVTPWAQKALEKAAEGVAEFEYERFDLGAERYLRDGAILP
EEEEERIKKTDAILLGAVGDPRIKAGILERGLLLKLRFDLDQYVNLRPSKLYKGVTSPLA
DPGDIDFVVVREGTEGLYCGAGGAVRRGTPNEVATEVSINTAYGVERVVRYAFQLAMKRR
KHVTLVHKKNVLVNAGDMWQRIVNTVAEEYPEVSHDYLHIDATTIFMVSDPSRFDVILTD
NLFGDIITDEAGAVVGGVGYSASGCINASDEYPSMFEPIHGSAPDIAGQNKANPTAAILS
AAMLLRHLGFDEAAARIDTAVEADIEELGSTTRSTDEVGRDILARM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacaacgaagaagtacaccatcgccgtcattccgggcgatggcatcggcaag
gaagtaaccccgtgggcccagaaggctctggagaaggcggccgaaggcgtcgccgaattc
gagtatgagcgcttcgatctgggagcggaacgctacctgcgtgacggtgcgatccttccg
gaagaggaagaggagcgcatcaagaagaccgacgcgatcctgctgggtgccgtcggcgat
ccgcgcatcaaggccggcattctggagcgcggcctgcttctgaaactccgtttcgatctt
gatcagtatgtgaacctgcgcccctccaaactgtacaagggcgtgacctcgcctctcgcc
gatccgggcgacatcgacttcgtggtggtgcgtgagggcaccgaaggcctgtattgcggt
gccggtggtgcggtccgccgtggcaccccgaacgaagtggccaccgaagtgtccatcaac
accgcttacggcgtggaacgtgtggtgcgctacgccttccagctggccatgaaacgcagg
aagcacgtgacgctcgtgcacaagaagaacgtgctcgtcaacgcgggcgacatgtggcag
cgcatcgtcaatacggtggcggaggagtatccggaagtctcccacgactatctgcacatc
gacgcgaccaccatcttcatggtatccgacccgtcccgtttcgacgtgattctgaccgac
aacctgttcggtgacatcattaccgacgaagccggtgccgtggtaggcggcgtgggctat
tccgcctccggttgcatcaacgcctccgacgagtatccgtcgatgttcgagccgatccac
ggttccgctccggacatcgcaggccagaacaaggccaatccgaccgctgcgatcctgtcg
gccgccatgctgctgcgccacctcggcttcgacgaggccgccgcacgcatcgacaccgca
gtcgaagcggatatcgaggagctgggttccaccacgcgttccaccgacgaggtcggccgc
gatattctggcacgtatgtaa

DBGET integrated database retrieval system