KEGG   Bifidobacterium dentium Bd1: BDP_1808Help
Entry
BDP_1808          CDS       T01143                                 

Gene name
gcvH
Definition
(GenBank) GcvH glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00260  Glycine, serine and threonine metabolism
bde00630  Glyoxylate and dicarboxylate metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01130  Biosynthesis of antibiotics
bde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BDP_1808 (gcvH)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDP_1808 (gcvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ADB10394
UniProt: D2Q629
Position
complement(2066081..2066461)
Genome map
AA seq 126 aa AA seqDB search
MNLEVPEHLEYSDEHVWVDASVEPAMVGITEYATEQLGELVYVDLPEVGAQVEAGDEVAE
LESAKAVTPLVCPVAGTIRYVNAEVSDDPSIITNDPYGEGWIFKIELEDDEPDLLSSGEY
ARIVTE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctcgaagtgcccgagcacctcgaatactccgacgagcatgtgtgggtcgacgcc
tccgtcgaacccgccatggtgggcatcaccgaatatgccaccgaacagctcggcgaactc
gtgtatgtggatctgcctgaggtcggtgcccaggtcgaggcgggcgatgaagtggcggag
cttgaatccgctaaggccgtgacccctctggtgtgcccggtggcgggcacgattcggtac
gtgaacgccgaggtttcggatgatccgagcatcatcacgaacgacccgtatggcgaaggc
tggatcttcaagatcgagctcgaagacgacgagccggatctgctcagttccggggaatac
gcgagaatagtcaccgaatag

DBGET integrated database retrieval system