KEGG   Bifidobacterium dentium Bd1: BDP_1812Help
Entry
BDP_1812          CDS       T01143                                 

Gene name
trxA
Definition
(GenBank) Thioredoxin
  KO
K03671  thioredoxin 1
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bde03110]
    BDP_1812 (trxA)
Chaperones and folding catalysts [BR:bde03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BDP_1812 (trxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_9 OST3_OST6 Thioredoxin_7 AhpC-TSA KaiB Redoxin Thioredoxin_3 TrbC_Ftype Glutaredoxin Thioredoxin_6
Motif
Other DBs
NCBI-ProteinID: ADB10399
UniProt: D2Q634
Position
2070965..2071327
Genome map
AA seq 120 aa AA seqDB search
MATHAVTSENFNEVIEGNDLVFVDFWATWCGPCRAFGPTFEKASEANPDIYFAKVDIDQN
PDLAQAAKVQAVPTLMVVKKQQIVFQQAGALRASDLDDLIGQAKALDVNAAASGRTGAEQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcatgcagtcacctctgagaacttcaacgaggtcatcgagggcaacgatctc
gtattcgtggatttctgggccacctggtgcggcccgtgccgcgcgttcggaccgactttc
gaaaaggcgagcgaagcgaaccccgacatctatttcgccaaggtcgatatcgatcagaat
cctgatctcgctcaggcggccaaggtacaggccgttccgacgctgatggtcgtcaagaag
cagcagatcgtgttccagcaggccggcgccctgcgcgcctccgatctggatgatctgatc
ggacaggccaaggcgttggatgtgaacgccgcagcttccggccgcaccggagccgaacag
tag

DBGET integrated database retrieval system