KEGG   Bifidobacterium dentium Bd1: BDP_1822Help
Entry
BDP_1822          CDS       T01143                                 

Gene name
wzy
Definition
(GenBank) Wzy putative exopolysaccharide polymerization protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EpsG NfeD
Motif
Other DBs
NCBI-ProteinID: ADB10407
UniProt: D2Q642
Position
complement(2081459..2082550)
Genome map
AA seq 363 aa AA seqDB search
MVYGVLMLVCCMLCLLMRIPRLRQFRCFGLVMMLTMMTTVSGLRSSNVGTDSPMYARLLR
HSGKCLKYNFEAGYCLLNGAIYWSGATYSVLFVLESLLLYSAIGLFIYQYVEERWWGFSC
LMIFGMRTFFTALNISRQYIAVALCMLAFMLYERKRWKLALGLVLLAMTFHITSIVVLLL
PFVRWWAQSEHFELQSIAAVVVTFLIQFFDCGGIIVWVAGFIPKYRHYQHDSLMNNTGTS
IFWVLYTLALSSVYIAYVWRKRLNQSNNVREGVQSECNEPLLLAGALIYVVMVNAFAGVG
TLNRMSIFFTMFFIWLLAALLAALSERMQIAVELVILAASFLMCYRQVYIRGNFGVLPYK
VFF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtttatggcgtgctgatgctggtctgttgcatgctatgtctactcatgcggatacca
aggctacggcaattccgatgtttcggcctggttatgatgctgacgatgatgacgaccgtt
tccgggttgcgttctagcaatgtcggtacggatagtcccatgtatgcgagattgcttaga
cactcgggcaaatgtctgaaatacaattttgaagctggctattgcttgctgaatggtgct
atatattggtcaggggccacttactccgtactattcgttctggagagtctcctgctatac
agtgccattggcctattcatttaccagtacgttgaagaacggtggtggggcttctcctgc
ctgatgattttcgggatgcgtacgtttttcacggccctgaacatctcccgtcagtacatc
gcagtggctttgtgcatgcttgcgttcatgctgtacgaacggaaacgctggaagctcgcg
ctgggtttggtgctgcttgccatgaccttccatatcacatccatcgtggtactgcttctc
cctttcgtgagatggtgggcgcaatccgagcacttcgaactgcagtccatagcggctgtc
gtcgtaactttcctgatacagttctttgactgtggaggcattatcgtctgggttgccggt
ttcattcccaaataccgtcactaccagcatgactcgctgatgaataacaccggaacgtcg
atattctgggtgctatacactctggcgttgtcgtcggtttatatcgcctacgtgtggcgg
aagcgtctcaatcagtcgaacaatgtgcgtgaaggggtgcaatccgagtgcaatgagccg
ttgctattggcgggagcactgatttatgtggtcatggtcaacgctttcgctggcgtaggc
accttgaaccgcatgtccattttcttcaccatgtttttcatctggttgctggcggctttg
cttgccgcactaagcgaacgcatgcagatcgcagtggaactggtgattctggccgcatcg
ttcctcatgtgttaccgacaggtctacatcagaggaaacttcggtgtgctgccctataag
gtatttttctga

DBGET integrated database retrieval system