KEGG   Bifidobacterium dentium Bd1: BDP_1825Help
Entry
BDP_1825          CDS       T01143                                 

Definition
(GenBank) Acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00270  Cysteine and methionine metabolism
bde00920  Sulfur metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01120  Microbial metabolism in diverse environments
bde01200  Carbon metabolism
bde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BDP_1825
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BDP_1825
Enzymes [BR:bde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     BDP_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ADB10410
UniProt: D2Q645
Position
2084378..2084947
Genome map
AA seq 189 aa AA seqDB search
MIQTKQDLCRFLSAERGAYLYGGRMDTLLAYLTDDPRAQIWRFQKRLRVCEYRYNNRHKT
PLHYVMFLWARRRKNRLGSRLGIEISENIFDEGLRLYHYGNIVVNGDTRIGKNCVLHGAN
CIGNAAKDFAAPHLGDDIDIGVGASIIGGVTIADGTIIGAGAVVTRSIPHKSTTVVGIPA
KPIRRGENI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgattcagacaaaacaagacttatgccgcttcctatccgcggaacggggcgcttacctg
tacggcggccgtatggatacactcctcgcctatctcaccgatgatccaagagctcagatt
tggcgtttccagaaacgtctgcgcgtatgtgaataccgatacaataaccggcataagacc
ccacttcattacgtaatgtttttatgggcgcgcaggaggaagaaccgtctaggaagccgt
cttggcatagagatttccgaaaatatcttcgatgaggggcttcgcctgtatcattacggc
aacattgtcgttaatggagacacacgaatcggcaaaaactgcgtgctgcacggtgccaat
tgcatagggaacgcggctaaagacttcgcagcacctcatttaggagacgatattgacatt
ggcgtcggagcatccatcatcggcggcgtgacgatagcggatggaacgatcatcggggcg
ggagccgtcgtcactcgctccataccgcataagagcaccactgtggtcggcattccggcc
aaaccgatacggaggggtgaaaacatatga

DBGET integrated database retrieval system