KEGG   Bifidobacterium dentium Bd1: BDP_1827Help
Entry
BDP_1827          CDS       T01143                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB10412
UniProt: D2Q647
Position
2086526..2088052
Genome map
AA seq 508 aa AA seqDB search
MSVSIPKQETSTAAPTRSRSIYARMVPIVVNSLFAAVLITLTDILSPIYPRVLETWYSDQ
YIFELTGKMWAEGGIPYVNFWDQKGPLIFLFNMLGWKLTESSLGIFLLTIVWAAVTVNML
YLLAREFTPQRHGTAMVVTIAWISAVWIGILCAPSWNLIEPLCLPFLAVSLLIAVRWFKQ
CDSDHGSVVPWWHPFVYGLSFSVCLLSRLTNALSVCVGVLVIAIMLLRWKQWMALLKCAL
SFIVGIALPLIPFCVYFAAHHAFYDFVYGTVLFNISYAGNSESLLSSQINTIVLILCLPC
AMVLVSLAHMLLERRCNPLDWTIAISGILFIVLFFNISPYQHYAAVAAIFLPILLGGVCR
YADQHIHMHWQTLVALGLVMALLCGYQAKVDNKLIWSEPTYDEPELEQVIQEAHGDIVLY
NVLVGAYLQYDLKPMYRFAWLQDWEASFSDSYAKLLREEFATARAKYIVVQPYYTMPKPA
IDRILHDRYKPVRTITVEGMDTVVYERR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttcaatccccaagcaagagacctcaacggctgcaccgacgcgatcccgatca
atctatgctcgcatggttccaatagtagtgaactcgctgttcgccgcagtgctcatcacg
cttacggacatcctctctcccatctacccccgcgtgcttgaaacgtggtactccgatcag
tacatcttcgagctcaccggcaagatgtgggccgagggcggcatcccatacgtgaatttc
tgggatcaaaaaggacctctgattttcctgttcaatatgcttggatggaaactcacggaa
tcctcattgggtatcttcctgctcaccattgtctgggccgccgtcaccgtgaatatgctg
tatctgcttgctcgggaattcactccccaacggcatggcacggcaatggtggtaacaata
gcgtggatatccgcggtatggatcggcattctctgcgctccttcctggaatctgatcgag
cccctctgtctgccgttcctcgccgtttccctgctgatcgccgtacgttggttcaaacag
tgcgacagcgatcacgggtccgtggtgccgtggtggcatcccttcgtatacggattgtcg
ttcagcgtctgcctgttgtcccgtctgaccaacgcgctatccgtatgcgtcggagtgctg
gtcatcgccatcatgcttctccggtggaaacagtggatggcgctgctcaaatgcgcgttg
tcgttcatcgtcggcatcgcactgccgctgataccgttctgcgtttacttcgcggcgcat
cacgcgttctatgatttcgtatacggcacggtgctgttcaacatcagctacgcgggcaat
tccgaaagcctgctctcctcgcaaatcaacaccatcgtgctcatactatgcctgccttgc
gcaatggtgctcgtatccttggcacacatgctgctcgagcgtcgctgcaatccccttgac
tggaccatagcgatatccggcatcttgttcatcgtactgttcttcaacatcagcccatac
cagcattacgccgcggtggcagccatcttcctgccgattcttctgggtggtgtatgccgg
tacgccgatcaacacatccacatgcactggcagacgctggtggcgttgggactggtcatg
gccttgttgtgcgggtaccaggccaaagtggacaataagctcatctggtcagaaccgacg
tatgacgaaccagaattggaacaggtcatccaagaggcccatggtgacatagtcctctac
aacgtgctcgtcggcgcatacctgcaatacgatctgaaaccgatgtaccgattcgcatgg
ctccaggattgggaggcgtcgttcagcgacagctatgcgaaactgctgcgtgaagagttc
gccaccgcccgtgcgaaatacatcgtggtgcagccgtattacacgatgccgaagcctgcc
atcgaccgcatccttcatgaccgatacaagcccgtacgcaccattaccgtggaaggaatg
gataccgttgtctatgaacgtcgataa

DBGET integrated database retrieval system