KEGG   Bifidobacterium dentium Bd1: BDP_1830Help
Entry
BDP_1830          CDS       T01143                                 

Definition
(GenBank) Acyltransferase 3
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 DUF5336
Motif
Other DBs
NCBI-ProteinID: ADB10415
UniProt: D2Q650
Position
2091179..2092249
Genome map
AA seq 356 aa AA seqDB search
MWLFSILVLIFAIMLVSGIHARGHEHDAFMSKAQTTSLRGLAILIVVIHHLGQRLDSALP
LTPYLMNFFIGYLAVGLFFFLSGYGNMLSISHMQRSFAGKMAWIVKRIIGLLLIFYVAEA
MALICELLSHQPIIPSLWGLITFSLPGWDTWYIKIQLLLYVLLFIAWLPDKLTANARLAL
LTVLVVIAIVVMKQCGLSEYWWNTLLCFPAGAFFAQYRQAAERLLQRYWAWAGCAFTVLF
MPAFLLNYRGQVLAGIPAALLFCCAVVSLNFKLCISSKPLIWLGTISFEIFLTHTFLLKT
LVLVNVWSLPRTHAMLPLLIGTLILSPINKAITDRIKALMPIFSSNAASRKKNHEE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtggttattttccatactggtactgatttttgcgattatgctggtttccggcatacat
gcgcggggacatgaacatgacgcattcatgtccaaagcgcagaccacatcgctccgcggc
ctggcgatcctcatcgtggtcattcaccacctgggccaacgtcttgattcagcattgcca
ttgacgccctatctcatgaacttcttcataggctatctggccgtgggattattcttcttc
ctttccggatacggcaacatgctgtcaatatcccatatgcaacgatcgttcgcagggaaa
atggcatggatcgtcaaacgcatcatcggcctgctgctgatcttctatgtcgcggaagcc
atggcgttgatctgtgagttgttgagtcatcaacccatcatccccagtctatggggactc
atcacgttctccctgcctggctgggatacgtggtacatcaaaatacagttattgctctac
gtactgcttttcattgcctggctaccggacaaactgaccgcaaacgcccgcctagcattg
cttaccgttctagtggtcatagccattgtcgttatgaagcaatgcggcttatccgaatat
tggtggaacactttgctgtgcttccccgccggtgcgtttttcgcccaataccggcaggcg
gccgaacgtctgctgcaacgctactgggcatgggcgggttgcgcgttcaccgtactcttt
atgcccgcgttcctgctgaattatcgaggtcaggtcctcgccggcatccccgcggcattg
cttttctgctgtgccgtagtttccttgaatttcaagctctgtatttcaagcaaacccttg
atatggctgggcaccatatcctttgagatattcctcacccacaccttcctgctgaagaca
ctagtgctggtcaatgtctggtccctgccaaggacccatgcgatgctgcctctgctgatc
ggcacgttaatcctgtcgccaatcaacaaagccatcaccgaccgcatcaaagcactcatg
ccgatattcagcagcaatgccgcttcaagaaagaagaatcatgaagaataa

DBGET integrated database retrieval system