KEGG   Bifidobacterium dentium Bd1: BDP_1842Help
Entry
BDP_1842          CDS       T01143                                 

Definition
(GenBank) Polysaccharide pyruvyl transferase
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_pyruv_trans
Motif
Other DBs
NCBI-ProteinID: ADB10425
UniProt: D2Q660
Position
complement(2103351..2104478)
Genome map
AA seq 375 aa AA seqDB search
MKIALITYHAAHNNGSFLQAFATQKAIEQLGHECDVIDFSTPRQQYLYDVYKKVSGPKDI
AKNAYAFFHHKLIQQRHDDFVNLQHKALGLTPKFYETVEQLEELNGKYDVFVSGSDQIWN
TDAWDYSDAYLLSFVHQGRKISYASSMGGHILDKKEDKALAEHYAKLLSGYQSIAVRELT
AQEYLQPLVPQHVEQVLDPTLLIDANAYDPITDAPLVHEPYIFYYAIDSIELNDSAAKAV
QAFAQSKGLPVYVMFTGNKSYGLKKYGFHLLEVAAPNHYLSLIKNADYVLSASFHGTAFS
IKFEKQFYVVRGKHNGKVNMDDRMSSLLKLCGLGSRQLIEGEPWDDSTIDYRSTNEKLGR
EVERSRAYLRDALKD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcactgattacctaccatgcagcccataacaatggttcgttcttgcaggcg
tttgccacgcagaaagccattgagcagctcggccatgaatgcgacgtcatcgatttttcc
acgccgcgccagcagtatctgtatgacgtgtataagaaggtgtccggtccgaaggacatt
gccaagaacgcgtatgccttcttccaccacaagctgattcagcaacgtcacgatgacttt
gtgaatttgcagcataaggcgttgggccttactccgaagttctatgagaccgtcgaacag
ttggaggaactcaatggcaagtacgatgttttcgtgtcaggcagtgatcaaatctggaac
acggacgcctgggattactccgacgcctacctgttgagcttcgtgcatcaaggacgtaag
atttcctacgcttctagcatgggcggccatatcctcgacaaaaaggaagacaaggctctt
gccgagcattatgccaaactgttgtccggctaccagtccatcgcggtgcgtgagctgacc
gcgcaggaatatctgcagccgttggtgccgcagcatgtggaacaggtactcgatccgacg
ttgctgattgatgccaatgcgtatgatcccatcaccgacgcacctttggtgcatgagccg
tacatcttctactacgccattgactccatcgaactcaatgattccgcggccaaggcggtc
caggcgtttgcacagagcaaggggctgccggtatatgtgatgttcactggcaataagtcc
tatggactgaagaaatatggtttccatctgcttgaagtggctgcgccaaaccattatctc
agcttgatcaagaacgccgactacgtgttgtccgcatccttccacggcacggcgttctcc
atcaaattcgagaagcagttctatgtggtacgcggcaagcacaacggcaaagtcaacatg
gacgatcgtatgagctcgttgctcaagctgtgtggattgggcagcaggcagctcattgaa
ggcgagccctgggatgattcgaccattgattatcgttctaccaatgaaaaactgggacgt
gaagtcgaacgctccagagcatacctgcgtgatgcactgaaggactag

DBGET integrated database retrieval system