KEGG   Bifidobacterium dentium Bd1: BDP_1851Help
Entry
BDP_1851          CDS       T01143                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD Glucos_trans_II
Motif
Other DBs
NCBI-ProteinID: ADB10434
UniProt: D2Q669
Position
complement(2111923..2113119)
Genome map
AA seq 398 aa AA seqDB search
MSNELGLGNKGSWWESRNKNAVLVLTFVVMLAAKLLTMMLPAKYFYDNNRIVGMVNEDMR
VKAWSGSYIVAANFFKAINIFGFTSISQWSWFLGMLLTVIVFFMVLRLPEPDMVQAIFLL
ACIGLLNIYVFSIGKDVIQFLFFMAVYLVLLMPIESSTMKIAFATVILYFESKVFRSYYV
LIAALVLAIYCILTMFRKNHKFPPAVKIIITTVTMYALVCVMMVVTSVAMHDEYEQIMGI
RDYSLNGREDDVDSVTIIKNWVGGDNSSNLPLFLLNYLINAIRMMIPFELAVKGIQYIPF
FCFQVAVTVYLVHLFGKLDEIEDETQFLAISIFLGYVLASVLFEPDFGSWVRHEAATFPV
LQLLVFSQNQRLSQWRQDISKIKGRIGRHANVAGKMEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgagcttggacttgggaacaaaggcagctggtgggagagccgtaacaagaat
gctgttctggttctcactttcgttgtgatgctggcagccaagctgctgaccatgatgctt
ccggcaaaatacttctacgataataaccgcatcgtcggcatggtcaatgaagatatgaga
gtaaaggcttggtccggtagctatattgtcgcggcgaacttcttcaaggccatcaacatc
tttggtttcacctccatcagccagtggagttggttcctaggaatgttgctgaccgtaatc
gtgtttttcatggtgctcaggcttcccgaacccgacatggtgcaagccatctttttgctg
gcctgcatcggcctattgaatatttacgtgttcagcatcggtaaggatgttattcaattc
ctgttcttcatggcggtctatctggtgttactgatgccgattgaaagttctaccatgaag
attgcttttgcaacggtaatcctgtatttcgagagcaaggtattccgttcctactatgtg
ctgattgccgcgcttgtgcttgccatttactgcattttgacgatgttccgcaagaatcat
aagtttcctcctgcggtcaagatcatcatcacgacggtgacgatgtatgcgctggtgtgc
gtgatgatggtggtgactagtgtggccatgcacgacgagtatgagcagatcatgggcatc
cgcgactacagcctgaacggtcgagaagatgacgtcgacagcgtcaccatcatcaagaac
tgggttggtggagacaattcctcgaatctgccattgttcctgctgaattatctgattaat
gcgattcgcatgatgattccatttgaactggcagtaaaaggcatacaatatataccgttc
ttctgtttccaggtcgctgtgaccgtatatctggtgcatctgttcggcaaacttgacgag
attgaagatgagacgcaatttctggccatttcgattttcctaggctatgtgcttgcgtcc
gtgttattcgaaccggattttggctcgtgggttcgtcatgaggcggctaccttcccagtg
ttgcaattgctggtattttcccagaatcagcgcttgtcccaatggagacaggacatcagt
aagattaagggacgcattggcagacatgcgaatgtggctggaaagatggaggcctga

DBGET integrated database retrieval system