KEGG   Bifidobacterium dentium Bd1: BDP_1853Help
Entry
BDP_1853          CDS       T01143                                 

Definition
(GenBank) acetyltransferase
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ADB10436
UniProt: D2Q671
Position
complement(2114284..2114775)
Genome map
AA seq 163 aa AA seqDB search
MVVVKLWYRFTGVLLKSLYKVIYGKSVHWGKSLHFRKGLQLTAEMGGTITIGDNVFFNND
CAVHAIKEVRIGSETIFGENVRVYDHNHRFADEKEAIKGQGYSTASVVIGEHCWIGSNVT
ILKGATIGDNCVIGAGCVIAENIPSNTVVRLEQQLLKEEVRHD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggtagtggtgaagctgtggtaccggtttaccggagtgctgctgaagtctctctataag
gttatctacggcaaatctgtccactggggcaaatcgttgcatttccgcaaggggttgcag
ttgactgccgagatgggtggcaccattaccatcggagacaatgttttcttcaacaacgat
tgcgcggtgcatgccatcaaggaggttaggatcggcagcgaaacgattttcggggagaac
gtacgtgtgtacgatcacaatcatcgttttgccgacgagaaggaagccatcaaaggccaa
ggctattccacggcgtcggtggtaatcggcgagcattgctggatcggcagcaatgtgacg
attctcaaaggcgccaccatcggagacaactgcgtgattggcgccggatgcgtgatagcc
gagaacattccttccaataccgtggtccgcttggaacagcagctgctcaaagaagaggtc
cgccatgactga

DBGET integrated database retrieval system