KEGG   Burkholderia diffusa: WI26_08585Help
Entry
WI26_08585        CDS       T04698                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00230  Purine metabolism
bdf00240  Pyrimidine metabolism
bdf01100  Metabolic pathways
bdf01110  Biosynthesis of secondary metabolites
bdf01130  Biosynthesis of antibiotics
Module
bdf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bdf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bdf_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WI26_08585
   00240 Pyrimidine metabolism
    WI26_08585
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bdf04131]
    WI26_08585
Enzymes [BR:bdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     WI26_08585
Membrane trafficking [BR:bdf04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    WI26_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AOI57652
UniProt: A0A1B4BSK6
Position
1:complement(1870548..1870973)
Genome map
AA seq 141 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGQIYSRFEGAGLKIVASRMAHLSRADAEKFYAVHAARPFF
KDLVDFMISGPVMIQVLEGEGAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD
AAETAAVEIAFFFPEMNVYSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgagcgcaccctgtcgatcatcaagccggatgcggtggcaaagaacgtgatc
ggccagatctacagccgtttcgaaggcgccggcctgaagatcgtcgcatcgcgcatggca
cacctgtcgcgtgcggacgcagagaagttctacgcagttcacgcggcacgtccgttcttc
aaggatctcgtcgatttcatgatctcgggcccggtgatgatccaggttctggaaggtgaa
ggcgcgatcctgaagaaccgcgacctgatgggcgcgacggatccgaagaaggcggaaaag
ggcacgatccgcgccgacttcgccgacagcatcgacgcgaacgccgtgcacggctcggac
gctgccgaaacggctgcggtcgaaatcgcgttcttcttcccggaaatgaacgtctactcg
cgctaa

DBGET integrated database retrieval system