KEGG   Burkholderia diffusa: WI26_11610Help
Entry
WI26_11610        CDS       T04698                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bdf  Burkholderia diffusa
Pathway
bdf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WI26_11610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bdf02000]
    WI26_11610
Enzymes [BR:bdf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     WI26_11610
Transporters [BR:bdf02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    WI26_11610
   Histidine transporter
    WI26_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N ABC_ATPase AAA_29 AAA_15 AAA_16 AAA_13 Zeta_toxin APS_kinase PRK DUF87 AAA_33 RsgA_GTPase RYDR_ITPR AAA_22 G-alpha AAA_30 AAA_23 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AOI58198
UniProt: A0A1B4BU60
Position
1:2517455..2518234
Genome map
AA seq 259 aa AA seqDB search
MNSQTQKLFVDDLHKRYGDNEVLKGVSLKANSGDVISVIGSSGSGKSTMLRCINFLEQPN
AGRIVVDGEEVRTTPDKTGALRAADSKQLQRVRTKLSMVFQHFNLWSHMNVIENVMEAPV
NVLGIPKKEAEDRAREYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGVPSE
VFANPKSERLRGFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccagactcagaagcttttcgtcgacgatctgcacaagcggtacggcgacaac
gaggtgctcaagggcgtgtcgctgaaggccaactcgggcgacgtgatcagcgtgattggc
tcgtccggttccggcaagagcacgatgctgcgctgtatcaacttcctcgagcagccgaac
gcgggccgcatcgtcgtcgacggcgaggaagtgcgcaccacgccggacaagacgggcgcg
ctgcgcgcggccgattcgaagcagctgcagcgcgtgcgcaccaagctgtcgatggtgttc
cagcatttcaatctctggtcgcacatgaacgtgatcgagaacgtgatggaagcccccgtc
aacgtgctcggcatcccgaagaaggaagccgaagaccgtgcacgcgagtatctcgaaaag
gtcggcctcgcgccgcgcgtcgagaagcagtatccgtcgcacttgtcgggcggccagcag
cagcgcgtcgcgatcgcgcgcgcgctggcgatgcatccggacgtcatgttgttcgacgag
cccacgtcggcgctggatccggaactggtcggtgaagtgctgaaggtgatgcagaagctg
gccgaggaaggccgcacgatgattgtcgtcacgcacgagatgggcttcgcgcgcaacgtg
tcgaatcacgtgatgttcctgcaccaggggcgcgtcgaggaagaaggcgtgccgtccgag
gtgttcgccaacccgaagagcgaacgcctgcgcgggttcctgtcgggcagcctcaaataa

DBGET integrated database retrieval system