KEGG   Burkholderia diffusa: WI26_11805Help
Entry
WI26_11805        CDS       T04698                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00860  Porphyrin and chlorophyll metabolism
bdf01100  Metabolic pathways
Module
bdf_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WI26_11805
Enzymes [BR:bdf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     WI26_11805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AOI58232
UniProt: A0A1B4BU84
Position
1:complement(2567011..2568513)
Genome map
AA seq 500 aa AA seqDB search
MNAPEPQPRGTLMIQGTTSDAGKSTLVAGLCRLARRAGARVAPFKPQNMALNSAVTADGG
EIGRAQALQALAAGVAPHTDFNPVLLKPTSDRGAQVIIHGKARMNLDARAYHDYKPVAFD
AVLESYARLRAGYDTVLVEGAGSPAEINLREGDIANMGFAERVDCPVVLVADIDRGGVFA
HLVGTLACLSDSERARVRGFVINRFRGDIKLLEPGLDWLRAQTGKPVFGVLPYLHGLTLD
AEDMLPSQARSAAARADAGVLRVVVPALPRISNHTDFDPLRAHPQVEFTYWKSGPVPDAD
LLILPGSKSVQRDLAWLRDTGWDALIRRHLRYGGKVIGICGGMQMLGRTLDDPLGLEGRP
GSVPGLGLLDFDTTLQPDKTLKNVTGHLALPGAAAVHGYEIHMGDTRGPALAAPALELAA
ADGPGGVRMDGARSADGQILATYVHGLFDAPDACAALLAWAGLDGAERIDYPALREASLE
RLADSFAEHLDLRALYAEFR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccgaaccgcagccgcgcggcacgttgatgatccagggcacgacgtccgac
gcgggcaagagcacgctcgtcgcgggcctgtgccgcctcgcgcgccgcgcgggcgcgcgt
gtcgcgccgttcaagccgcagaacatggcgctgaacagcgcggtgacggccgatggcggc
gagatcggccgcgcgcaggcgttgcaggcgctcgccgcgggcgtcgcgccgcataccgat
ttcaacccggtgctgctgaagccgacgagcgatcgcggcgcgcaggtgatcatccacggc
aaggcgcgcatgaacctcgatgcgcgggcgtaccacgactacaagccggtcgcattcgac
gcggtgctcgagtcgtacgcgcggctgcgtgccggctacgacacggtgctcgtcgaaggc
gcgggcagcccggccgagatcaacctgcgcgaaggcgacatcgcgaacatgggcttcgcg
gaacgcgtggactgcccggtcgtgctggtcgcggacatcgaccgcggcggcgtgttcgcg
cacctggtcggcacgctcgcgtgcctgtcggacagcgagcgtgcgcgcgtgcgaggcttc
gtcatcaaccgctttcgcggcgacatcaagctgctcgaaccgggcctcgactggctgcgc
gcgcagacgggcaagccggtgttcggcgtgctgccgtacctgcacggattgacgctcgat
gccgaggacatgctgccgtcgcaggcgcgcagcgccgccgcacgcgccgacgccggcgtg
ctgcgggtggtggtgcccgcgctgccgcggatcagcaaccataccgatttcgatccgctg
cgcgcgcatccgcaggtcgagttcacgtactggaagagcggcccggtgcccgatgccgac
ctgctgatcctgcccggctccaagagcgtgcagcgcgatctcgcgtggttgcgcgacacg
ggctgggacgcgctgatccgccggcacctgcgctatggcggcaaggtgatcggcatctgc
ggcgggatgcagatgctcggccgcacgctggatgatccgctcggcctcgaaggcaggccc
ggcagcgtgccggggctcgggctgctcgatttcgacacgacgctgcagccggacaagacg
ctgaagaacgtgaccgggcatctcgcgctgccgggcgcggccgccgtgcatggctacgag
atccacatgggcgacacgcgcggacccgcgctcgcggcgcccgcgcttgaactggcggcg
gccgatgggccgggcggcgtgcgcatggacggcgcaaggtcggccgacgggcagattctc
gcgacctacgtgcacgggctgttcgacgcgcccgacgcgtgtgcggcactcctcgcatgg
gcggggctcgacggcgcggagcgcatcgactacccggcgctgcgcgaggcgtcgctggag
cggctggccgattcgttcgccgagcatctcgacctgcgcgcgctgtacgccgagttccgc
tga

DBGET integrated database retrieval system