KEGG   Burkholderia diffusa: WI26_21635Help
Entry
WI26_21635        CDS       T04698                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WI26_21635
Enzymes [BR:bdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     WI26_21635
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     WI26_21635
    1.1.1.-  
     WI26_21635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AOI60196
UniProt: A0A1B4BZV4
Position
2:1420165..1421229
Genome map
AA seq 354 aa AA seqDB search
MKAAVWHGRNDIRVEEVPVPAHPPAGWVQIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAALGAGVTGFAVGERVTADACQHCGACWYCRHGLYNICENLAF
TGLMNNGAFAEFVNVPAELLYKLPDDFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGATVVIDPKASDAIAEVKALTDGY
GADVSFECIGHTATAQLAIDVIRKAGKSVMVGIFEEPTSFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVRPLITGRISLDDIVTHGFEELVNHKDRNVKIIVQPATA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcacggccgcaacgacatccgcgtcgaggaggtacccgttccg
gcgcatccgccggccggttgggtccagatccgcgtgcactggtgcgggatctgtgggtcc
gacctgcacgagtacgtcgccggcccggtgttcatcccggtcgacgcgccgcacccgctg
acgggcctgaagggccagtgcatcctcggccacgagttcagcggcgaaatcgcagcgctc
ggcgccggcgtgacgggcttcgcggtcggcgagcgcgtgacggccgacgcgtgccagcat
tgcggcgcctgctggtattgccggcatgggctatacaacatctgcgagaacctcgcgttc
accggactgatgaacaacggcgcgttcgccgaattcgtcaacgtgccggccgagctgctg
tacaagctgcccgacgacttcccgaccgaggccggcgcgctgatcgagccgctcgcggtc
gggctgcatgcggtgaagaaggccggcaacatcgtcggccagacggtcgtcgtggtcggc
gccggcacgatcggcctgtgcacgatcatgtgcgcgaaggccgcgggcgccggacgcgtg
atcgcgctggaaatgtcggccgcgcgcaagcagaaggcgctggaagtcggcgcgacggtc
gtgatcgacccgaaggcgtccgacgcgatcgcggaagtcaaggcgctgacggacggctac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccaccgcgcaactcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcatcttcgaggagccgacgtcgttc
aacttcttcgacatcgtgtcgaccgaaaaggaagtgatcggctcgctcgcgtacaacggc
gaattcgcggacgtgatccgcttcatcgcggacggccgcatcgacgtgcgtccgctgatc
accggacgcatcagcctggacgacatcgtcacgcacggcttcgaagaattggtcaaccac
aaggaccggaacgtgaagatcatcgtccagcccgcgaccgcctga

DBGET integrated database retrieval system