KEGG   Burkholderia diffusa: WI26_21660Help
Entry
WI26_21660        CDS       T04698                                 

Definition
(GenBank) phenylacetate--CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00360  Phenylalanine metabolism
bdf01100  Metabolic pathways
bdf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    WI26_21660
Enzymes [BR:bdf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     WI26_21660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding
Motif
Other DBs
NCBI-ProteinID: AOI60201
UniProt: A0A1B4BZX0
Position
2:complement(1424761..1426083)
Genome map
AA seq 440 aa AA seqDB search
MTHPTHPAAALEPIETASRDELQALQLERLKWSLRHAYDNVPHYRRTFDAAGVHPDDLKT
LADLAKFPFSTKNDLRDNYPFGLFAVPREQVVRVHASSGTTGKPTVVGYTARDIDTWANV
TARSIRAAGGRPGDTLHNAFGYGLFTGGLGIHYGAERLGCMVVPMSGGQTEKQVQLIRDF
EPKIILVTPSYMLNLIDEMVRQGMDPAESSLKIGIFGAEPWTQALREEVETRVGIDALDI
YGLSEVMGPGVACECVETKDGPVIWEDHFYPEIIDPATGEVLPDGSEGELVFTSLTKEAM
PVIRYRTRDLTALLPPTARAMRRLAKITGRSDDMLIVRGVNVFPSQVEEIVVAQPKLSGQ
FQITISRDGHMDRLDLAVELRSEAAASVTDGDRAAIARELQHRIKTMIGVSAGVTVLAAG
GIPASATGKARRVIDRRQAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactcacccgacgcatcccgcggccgctctcgagccgatcgagaccgccagccgcgac
gaactgcaggcgctgcagctcgagcgcctgaagtggtcgctgcgccacgcgtacgacaac
gtcccgcactatcgccgcacgttcgacgcggcgggcgtgcatcccgacgacctgaagacg
ctcgccgacctcgcgaaattcccgttctcgaccaagaacgacctgcgcgacaactatccg
ttcgggttgttcgcggtaccgcgcgagcaggttgtgcgcgtgcatgcgtcgagcggcacg
accggcaagccgacggtggtcggctacaccgcgcgcgacatcgatacctgggcgaacgtg
accgcgcgctcgatccgcgcggccggcggccgcccgggcgacacgctgcacaacgcgttc
ggctacgggctcttcacgggcggcctcgggattcactacggcgcggagcgcctcggctgc
atggtcgtgccgatgtcgggcggccagaccgagaagcaggtgcaactgattcgcgatttc
gagccgaagatcatcctcgtcacgccgtcgtacatgctgaacctgatcgacgagatggtg
cggcagggcatggatccggcggagtcgtcgctgaagatcggcatcttcggcgcggagccg
tggacgcaggcgttgcgcgaggaagtggaaacgcgcgtgggcatcgatgcgctcgacatc
tacgggctgtcggaagtgatggggccgggcgtcgcgtgcgaatgcgtggagacgaaggac
ggcccggtgatctgggaagaccatttctatccggagatcatcgatcccgcgaccggcgag
gtgctgccggacggcagcgagggcgagctcgtgttcacgtcgctgacgaaggaagcgatg
ccggtgatccgctatcgcacgcgcgacctcaccgcgctgctgccgccgaccgcgcgcgcg
atgcgccggctcgcgaagatcacgggccgctccgacgacatgctgatcgtgcgcggcgtg
aacgtgtttccgagccaggtcgaggaaatcgtcgtcgcgcagccgaagctgtcggggcag
ttccagatcacgatctcgcgcgacggccatatggaccggctcgacctcgcggtcgagctg
cgctccgaggccgccgcgagcgtgaccgacggcgatcgcgcggcgatcgcgcgcgagctg
cagcaccggatcaagacgatgatcggcgtgtcggccggcgtgacggtgctcgccgcgggc
ggcattcccgcgagtgcgaccggcaaggcccggcgggtcatcgaccgccggcaggccgcc
tga

DBGET integrated database retrieval system