KEGG   Burkholderia diffusa: WI26_24105Help
Entry
WI26_24105        CDS       T04698                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00051  Fructose and mannose metabolism
bdf01100  Metabolic pathways
bdf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WI26_24105
Enzymes [BR:bdf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     WI26_24105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AOI60635
UniProt: A0A1B4C141
Position
2:complement(1970644..1971921)
Genome map
AA seq 425 aa AA seqDB search
MPIIRSMRVLDVRFPTSRQLDGSDAMNPDPDYSAAYVVLETDHDGLQGHGLTFTIGRGNE
ICCAAIDAMRHLVVGLDLDWIREDMGRFWRHITSDSQLRWIGPDKGAIHLATGAVVNAVW
DLWAKAAAKPLWRLIADMSPEEIVRAIDFRYLTDCLTQDEALDLLRRQAPGKAERIAALE
RDGYPCYTTSAGWLGYSDDKLRRLCREAVDAGFDHVKLKVGANMEDDIRRVTIAREVIGP
NRKLMIDANQVWEVDVAIDWVRELAFAKPWFIEEPTSPDDVEGHRKIREAIAPVQVATGE
MCQNRVLFKQFIARGAIDVVQIDACRLGGVNEILAVMLLAAKYGLPVCPHAGGVGLCEYV
QHLSMIDYVCISGTKEGRVTEYVDHLHEHFVEPCVVRGAAYMPPTAPGFSIEMKPESLEQ
YRFRG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcattcgatcgatgcgcgtcctcgacgtgcgcttcccgacttcgcggcagctc
gacggctccgacgcgatgaatccggaccccgactattcggccgcgtacgtcgtgctcgaa
accgaccacgacgggctccagggccacgggctgacgttcacgatcgggcgcggcaacgaa
atctgctgcgcggcgatcgacgcgatgcgtcacctcgtcgtcggcctcgacctcgactgg
attcgcgaggacatgggccgcttctggcggcacataacgtcggacagccagttgcgctgg
atcggccccgacaagggcgcgatccacctggccacgggcgccgtcgtcaacgcggtgtgg
gacctttgggcgaaggccgcggccaaaccgctttggcggctcatcgcggacatgagcccc
gaggagatcgtgcgcgcgatcgatttccgctacctgaccgattgcctgacgcaggacgaa
gcgctcgacctgctgcgccggcaggcgccgggcaaggcggagcggatcgcggcgctcgag
cgcgacgggtacccgtgctacacgacgtcggcgggctggcttggctacagcgacgacaag
ctgcgccggttgtgtcgagaagctgtggacgccggcttcgaccacgtgaagctgaaggtc
ggcgcgaacatggaggacgacatccgccgcgtgacgatcgcgcgcgaagtgatcggcccg
aaccgcaagctgatgatcgacgcgaaccaggtgtgggaggtcgacgtcgcgatcgactgg
gtacgcgagctggcattcgcgaaaccgtggttcatcgaggagccgacgagccccgacgac
gtcgaagggcatcgcaagatccgcgaggcgatcgcgccggtgcaggtcgcgaccggcgag
atgtgccagaaccgcgtgctgttcaagcagttcatcgcgcgcggcgcgatcgacgtcgtg
cagatcgacgcgtgccggctcggcggcgtgaacgagattctcgcggtgatgctgctggcc
gcgaagtacgggctgccggtgtgtccgcatgcggggggcgtcggactgtgcgaatacgtg
cagcatctgtcgatgatcgactacgtatgcatttccggcacgaaggaagggcgcgtgacc
gaatacgtcgatcatctgcacgagcatttcgtcgagccgtgcgtcgtgcgcggcgcggct
tacatgccgccgacggcgcccggtttttcgatcgagatgaagcctgaatcgctcgagcag
tatcggttccgcggctga

DBGET integrated database retrieval system