KEGG   Burkholderia diffusa: WI26_25240Help
Entry
WI26_25240        CDS       T04698                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    WI26_25240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOI60847
UniProt: A0A1B4C1P1
Position
2:2246986..2248578
Genome map
AA seq 530 aa AA seqDB search
MNQPASSAPNNSGSVERTRQVGYAVFLLVLAFGAGYIATHLIADLSPVREGSLFPYLMLG
AALLIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGMWNFLGVMVSSGAVAFGIL
QLLPVELILQVGSGAGFAMVFALLIAAIMWNLATWYFGLPSSSSHTLIGSIIGVGLMNQL
MHGPTGTSGVDWGQALGVGKSLLFSPIVGFLCAALLLLVLKALVRIPDLYQEPPKDQPPP
FWIRCLLIVTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPAETQTFVAVA
NQAAATFGKYTNGVAPSANPRADVEHYVQHRELTPAVLPAVQQLSTSLATAVGASGSMAA
VPQRDVDNVRNTMYLVSEAIRLIEKSGKPAFAADDKLAIDNYRKQLDHATKFIPTWVKVA
VAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAELVAMLTIGAADAYGLPVSTTHV
LSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLAGGLYWLFRSVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacctgcttcgtccgcaccgaacaattcgggttccgtcgaacgcaccaggcag
gtcggctatgccgtgttcctgctggtgctcgcgttcggcgccggctatatcgccacgcac
ctgattgccgatctgtcgccggtccgcgaagggtcgctgttcccgtacctgatgctcggc
gccgcgctgctgatcgcgctcggcttcgaattcgtcaacggcttccacgacaccgcgaac
gcggtggccaccgtgatctatacccactcgctgacgcccaacgtcgcggtgatctggtcc
ggcatgtggaacttcctcggcgtgatggtctcgagcggcgccgtcgcattcggcatcctg
cagttgctgccggtcgagctgatcctgcaggtcggtagcggcgcgggtttcgcgatggtg
ttcgcgctgctgatcgccgcgatcatgtggaacctcgcgacctggtatttcgggttgccg
tcgtcgagctcgcatacgctgatcggatcgatcatcggcgtcggcctgatgaatcagttg
atgcacgggcccaccggcacgagcggcgtcgactggggccaggcgctcggcgtcggcaag
tcgctgctgttctcgccgatcgtcggcttcctgtgcgccgcactgctgctgctcgtgctg
aaagcactcgtgcggattcctgatctgtaccaggagccgccgaaggatcagccgccgccg
ttctggattcgctgcctgttgatcgtgacctgcacgggtgtgtcgttcgcacacggatcg
aatgacgggcaaaaagggatgggcctcatcatgctgatcctgatcggcacggtgccgacc
gcgtatgcgctgaacaaggccgtcacgccggccgaaacgcagaccttcgtcgccgtcgcg
aaccaggctgccgcgacattcgggaagtacacgaacggcgtcgcgccgtccgcgaacccg
cgcgccgacgtcgaacactacgtgcagcatcgtgaactgacgcccgccgtgctgcctgcc
gtgcaacagctgtccacgtcgctcgcgaccgcggtcggcgcgtcggggtcgatggcggcg
gtgccgcaacgcgacgtcgacaacgtgcgcaacacgatgtatctggtgtccgaggcgatt
cgcctgatcgagaaatcgggcaagcccgcgttcgccgccgacgacaagctcgcgatcgac
aactatcgcaagcaactcgaccacgcgacgaagttcattccgacgtgggtgaaggtcgcc
gtcgcgatcgcactgggcctcggcacgatggtcggctggaagcgaattgtcgtaaccgtt
ggcgagaagatcgggaagcagcatttgacgtatgggcagggtgcgtccgccgaactcgtc
gcgatgctgacgatcggtgcagccgacgcatacgggctgcccgtgtcgacgacgcacgtg
ctgtcgtcgggcgtcgcgggcacgatggccgcgaatggatcggggttgcagtggagcacg
gtgcgcagcctcgtgctcgcgtgggtgctgacgctgcccgcgtcgatcgtgctggcaggc
gggctctactggttgttccggtcggtggcttga

DBGET integrated database retrieval system