KEGG   Burkholderia diffusa: WI26_26975Help
Entry
WI26_26975        CDS       T04698                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00071  Fatty acid degradation
bdf00072  Synthesis and degradation of ketone bodies
bdf00280  Valine, leucine and isoleucine degradation
bdf00310  Lysine degradation
bdf00362  Benzoate degradation
bdf00380  Tryptophan metabolism
bdf00620  Pyruvate metabolism
bdf00630  Glyoxylate and dicarboxylate metabolism
bdf00640  Propanoate metabolism
bdf00650  Butanoate metabolism
bdf00900  Terpenoid backbone biosynthesis
bdf01100  Metabolic pathways
bdf01110  Biosynthesis of secondary metabolites
bdf01120  Microbial metabolism in diverse environments
bdf01130  Biosynthesis of antibiotics
bdf01200  Carbon metabolism
bdf01212  Fatty acid metabolism
bdf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WI26_26975
   00630 Glyoxylate and dicarboxylate metabolism
    WI26_26975
   00640 Propanoate metabolism
    WI26_26975
   00650 Butanoate metabolism
    WI26_26975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WI26_26975
   00072 Synthesis and degradation of ketone bodies
    WI26_26975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WI26_26975
   00310 Lysine degradation
    WI26_26975
   00380 Tryptophan metabolism
    WI26_26975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WI26_26975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WI26_26975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WI26_26975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdf04147]
    WI26_26975
Enzymes [BR:bdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WI26_26975
Exosome [BR:bdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WI26_26975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AOI61370
UniProt: A0A1B4C369
Position
3:46811..48004
Genome map
AA seq 397 aa AA seqDB search
MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVSEVLSRANVPGDAVGHVVFGHV
VNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAAQTIMLGDADVAIGGGS
ENMSRAPYSVPSARFGQRMGDAKLVDMMLGALHDPFQTIHMGVTAENVAKKYGISRDAQD
ALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEHVRHDAGPDDFTKLKPVFV
KEDGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLVAYAHAGVDPAYMGIGPVPA
TQKALERAGLKITDLDVIEANEAFAAQACAVTQELGLDPAKVNPNGSGISLGHPIGATGA
LITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcagcgaaggaagtcgtggtggtgagcggtgtccgtaccgcgatcggcgat
ttcggcgggagcctgaaggatttctcgccgaccgatctcggggcgaaggtcgtgagcgaa
gtgctgtcgcgcgcgaacgtgccgggcgacgcagtcgggcatgtcgtgttcggccacgtc
gtgaacaccgagcccaaggacatgtatctcgcgcgcgtggcggcgatcaacggcggtgtc
gcgcagcacacgccggcgctgaccgtgaaccgcctgtgcggctcgggcctgcaggcgatc
gtgtcggccgcgcagacgatcatgctcggcgacgccgacgtcgcgatcggcggcggttcg
gagaacatgagccgcgcgccgtacagcgtgccgtccgcgcgcttcggccagcgcatgggc
gatgcgaagctcgtcgacatgatgctcggcgcgctgcatgacccgttccagacgatccac
atgggcgtgacggccgagaacgtcgcgaagaaatacggcatttcgcgtgatgcgcaggat
gcgctcgcgctcgaatcgcatcgtcgcgcggcgcgcgcgatcgcggaaggccgcttcaag
gaccagatcctgccgatctcgatccgcacgaagaagggcgaggtcgcgttcgacaccgac
gagcacgtgcgccacgacgcgggcccggacgatttcacgaagctgaagccggtgttcgtg
aaggaggacggcacggtgacggcaggcaacgcgtcggggatcaacgatgccgctgccgcg
gtgctgatgatgagcgcggacgccgcgcgcgcgcagggcgtgaagccgctcgcgcgtctg
gtcgcgtatgcgcatgcgggcgtcgatccggcgtacatgggcatcggcccggtgccggcc
acgcagaaggcgctcgaacgcgccggtctcaagatcaccgatctcgacgtgatcgaggcg
aacgaagcgttcgccgcacaggcatgcgcggtcacgcaggagctcggcctcgatccggcc
aaggtcaacccgaacggatcgggcatttcgctcggccacccgatcggtgcgacgggcgcg
ttgatcacggtcaaggcgctgtacgagctgaagcgcatcggcgggcgttatgcgctcgtg
acgatgtgtatcggcggcggccaggggattgcggcgatcttcgagaacatctga

DBGET integrated database retrieval system