KEGG   Burkholderia diffusa: WI26_27325Help
Entry
WI26_27325        CDS       T04698                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00520  Amino sugar and nucleotide sugar metabolism
bdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    WI26_27325
Enzymes [BR:bdf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     WI26_27325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short SH3_16 KR
Motif
Other DBs
NCBI-ProteinID: AOI62010
UniProt: A0A1B4C527
Position
3:complement(131055..132098)
Genome map
AA seq 347 aa AA seqDB search
MKGYDRKRVLVTGGAGFLGSHLCERLVTAGHDVLCVDNFYTGTKDNIAHLLDAPNFELMR
HDVTFPLYVEVDEIYNLACPASPVHYQRDPVQTTKTSVHGAINLLGLAKRVKARILQAST
SEVYGDPDVHPQDERYCGRVNPIGVRACYDEGKRCAETLFMDYHRQYGVDVRIARIFNTY
GPRMHPADGRVVSNFITQALAGEPLTVYGDGKQTRSFCYVDDMVDALVRLMDEPGDACEP
VNLGSDDEIAMIDVAREVVRIVGATVAIEFCPLPSDDPRQRRPDLDVAHRRLGWRATTPL
ASGLAHTARYFIHRQVVRHTPGDLVRSTQIASHMLAQISTQNRPATT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctacgatcgcaaacgggtgctcgtcacgggcggggccgggtttctcggttcg
catctgtgcgagcgcctcgtcacggccggacacgacgtactgtgcgtcgacaatttctac
accgggacgaaggacaacatcgcgcacctgctcgatgcgccgaacttcgagctgatgcgg
cacgacgtgacgtttccgctatacgtcgaggttgacgagatctacaacctcgcatgcccg
gcatcgcccgtgcattatcaacgcgacccggtgcagacgaccaagaccagcgtgcacggc
gcgatcaacctgctcggcctcgcgaagcgcgtgaaggcgcgcatcctgcaagcgtcgacg
agcgaggtgtacggcgaccccgacgtgcatccgcaggacgagcgctactgcggccgcgtg
aacccgatcggcgtgcgcgcgtgctacgacgaaggcaagcgctgcgcggaaacgctgttc
atggactatcaccgccagtacggcgtcgacgttcggatcgcgcgaatcttcaacacgtac
gggccgcgcatgcatccggccgacgggcgcgtcgtgtccaacttcatcacgcaggcgctg
gccggcgagccgctgaccgtctacggcgacggcaaacagacgcgctcgttctgctatgtc
gacgacatggtggatgcgctggtccggctgatggacgaaccgggcgacgcatgcgagccg
gtgaacctcggcagcgacgacgagatcgcgatgatcgacgtcgcgcgcgaggtcgtgagg
atcgtcggcgcgacggtcgcgatcgaattctgtccgctgccgtccgacgacccgcgccag
cggcggcccgatctcgatgtcgcgcaccggcgcctcggctggcgcgcgacgaccccgctc
gcgagcgggctcgcgcataccgcgcggtatttcatccatcggcaagtcgtgcgtcacacg
ccgggcgacctcgtgcgcagcacgcagatcgcgtcgcacatgctcgcgcagatcagcacg
cagaaccggccggcgacgacctga

DBGET integrated database retrieval system