KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_07570Help
Entry
GV66_07570        CDS       T03263                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Pathway
bdh00471  D-Glutamine and D-glutamate metabolism
bdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GV66_07570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdh01011]
    GV66_07570
Enzymes [BR:bdh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     GV66_07570
Peptidoglycan biosynthesis and degradation proteins [BR:bdh01011]
 Precursor biosynthesis
  Racemase
   GV66_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AII67568
UniProt: A0A076J0L9
Position
complement(1970063..1970908)
Genome map
AA seq 281 aa AA seqDB search
MIPSLPPSTGPIGVFDSGYGGLTILDKIRGLMPEYDYIYLGDSARCPYGPRSFEVVYEFT
LQAVSKLFELGCPLVILACNTASAKALRTIQQINLPVIDATRRVLGVIRPTAECIGEITR
SRHVGILATAGTIKSESYLLEIHKLSPDIVVTGEACPMWVSLVENNEYQSEGADYFVKQH
INRLLDKDPVIDTIILGCTHYPLLLDKIRQFTPGHIRIIAQGEYVARSLQDYLNRHPEMD
ARCEKGGKCRFLTTESENKFEESASIFLGRQDIKVESIALE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcccatctctccccccttcaaccggccctatcggtgtattcgactccggctacggt
ggtctaaccattctggacaaaatacgcggactgatgcctgaatatgattatatctatttg
ggagacagcgcacgctgtccatacggaccgcgctcctttgaagttgtttacgaatttacc
ttgcaagccgtaagcaaactgttcgaactaggatgccctttggtgatattagcatgcaac
acagcatcggcaaaagccttacgcaccatccagcagatcaatcttccggtaatagacgct
acccgcagagtactcggggtcatccggcctacagcagaatgtataggagaaatcacccga
agccggcacgtaggcatactggccacagccggtaccatcaaatccgaatcctatcttttg
gaaatacataaattatctcccgacattgtggtaacaggagaagcctgtcccatgtgggtt
tccttagtagagaataatgaatatcaatcggaaggagccgactatttcgtcaaacaacat
atcaaccggctgctggataaagacccggtgattgacaccatcatactgggatgtacccat
tatccgttactgcttgataaaataagacagtttactcccggacatatccgcatcatcgca
caaggagaatatgtagcccgaagtctgcaggactatttgaaccgccatcctgaaatggac
gcacgttgcgaaaaaggaggaaagtgccgcttccttaccaccgaaagtgaaaacaagttc
gaggaatccgcttccatcttcttaggtcggcaggacataaaagtagaaagcatagcattg
gaataa

DBGET integrated database retrieval system