KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_15295Help
Entry
GV66_15295        CDS       T03263                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Pathway
bdh00030  Pentose phosphate pathway
bdh00480  Glutathione metabolism
bdh01100  Metabolic pathways
bdh01110  Biosynthesis of secondary metabolites
bdh01120  Microbial metabolism in diverse environments
bdh01130  Biosynthesis of antibiotics
bdh01200  Carbon metabolism
Module
bdh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bdh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GV66_15295
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GV66_15295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdh04147]
    GV66_15295
Enzymes [BR:bdh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     GV66_15295
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     GV66_15295
Exosome [BR:bdh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GV66_15295
  Exosomal proteins of colorectal cancer cells
   GV66_15295
  Exosomal proteins of bladder cancer cells
   GV66_15295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N IclR
Motif
Other DBs
NCBI-ProteinID: AII68979
UniProt: A0A076ISC0
Position
3769915..3771423
Genome map
AA seq 502 aa AA seqDB search
MSLPHSLFLVIFGASGDLTRRKLMPALIKIHNGKRFPEHFAIIGCARTAYTDETYRAYLK
EELIKSGSLTKEEMETLDDFLSTVHYQSMDPADETTYSLLNDRLKELSPQYENNGNYLFY
LATPPLLYELIPKYLHDAGLLKKPGLKRIIVEKPFGYDLASAQKLNKIYAAYFKEEDIYR
IDHFLGKETVQNIMVTRFGSTIYEPIWNRNYIDHVEITAVENMGIGTRGGYYDGAGALRD
MVQNHLMQLLAITAMEPPAKFDKNGFRNEVIKVYQSLRPLTDEYIRDNVVRGQYIAGDDR
IGYREEKNVHPDSRTDTYVAMCLYVDNWRWQGVPFYIRTGKQMPTKVTEIVIHFKPAPMQ
MFQMKEGLYKGEELIIRIQPDEGILQRIAMKEPGAGFYMGTMEMDFSYDQHDQETGDAYV
RLLEDSLAGDPTLFTRSDAVDESWTYFDKILDYWKKHPETPLYGYPAGTWGPKEADVLIN
RSHAEWTNPCKNLTHSNLYCKL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaccacatagtttatttttggtcatcttcggtgcatccggtgatttaacccgg
cgcaaactgatgcctgccctgataaagatacataacgggaaacgtttccccgagcatttt
gccattatcggctgtgcccgtactgcatatacggacgaaacctatcgtgcttatctgaaa
gaagaactgataaagtccggttctcttacaaaagaagagatggaaacattggacgatttt
ctctctactgtccattatcagtccatggacccggcggacgaaaccacttattctctgctg
aatgaccgtctgaaggagctttcacctcaatatgagaataatgggaattatttattctac
ctggccactccgccattgctttatgaactgattccgaaatatctgcatgatgcgggcttg
ctgaaaaagcccggattaaagcgtatcattgtcgagaagccttttggatacgacctggct
tctgctcagaaactgaataagatctatgccgcttattttaaagaagaggatatttaccgt
atcgatcatttcctaggcaaggaaacggtacagaatattatggtgacccgttttggaagt
accatttacgaaccgatatggaaccgtaactatatagatcatgtggaaatcactgcggtg
gaaaatatgggtataggtactcgcggagggtattatgacggggcgggagctctgcgtgat
atggtacagaaccacctgatgcagttgcttgccattactgccatggaaccgcctgccaag
tttgacaagaatggttttcgtaacgaggtgatcaaagtctatcagtcccttcgtccgctg
actgatgagtatatccgtgataacgttgtccgcggacaatatattgccggtgacgaccgt
atcggttatcgtgaagaaaagaatgttcatcctgattcccgtacggatacctacgtggcg
atgtgcctgtatgtggacaactggcgttggcagggagtacctttttatatccgtaccggc
aagcagatgcctaccaaggtgaccgaaattgtgattcatttcaaaccggcccctatgcag
atgtttcaaatgaaggagggcttgtacaaaggcgaggaactgattatccgtattcagccc
gacgagggaattcttcagcgcatagccatgaaagaacctggtgccggtttctatatggga
accatggagatggatttcagctatgaccagcacgatcaggaaacgggggatgcgtacgta
cgcctgttggaagacagtctggcgggtgatcctacactttttacccgttccgatgccgtg
gacgagagctggacttactttgacaagattctggattattggaagaagcatcccgaaact
cctctttatgggtatcctgcaggaacatggggaccgaaagaagcggatgtgttgatcaac
cgcagtcatgccgaatggacaaacccgtgcaagaatctgacacattccaatttatactgt
aaattgtaa

DBGET integrated database retrieval system