KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_21215Help
Entry
GV66_21215        CDS       T03263                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Pathway
bdh00520  Amino sugar and nucleotide sugar metabolism
bdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GV66_21215
Enzymes [BR:bdh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     GV66_21215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-ProteinID: AII70026
UniProt: A0A0K2HNY0
Position
complement(4998355..4999293)
Genome map
AA seq 312 aa AA seqDB search
MKRILVTGGAGFIGSHLCTRLIEEGNIVICLDNFFTGSKENISYLTGHPRFELIEHDIIN
PFWTDVDEIYNLACPASPIHYQHDAIKTAKTAVFGTFNMLGLAKRNKAKILQASTSEVYG
DPLSHPQREGDWGNVNPIGYRSCYDEGKRCAETLCMDYYRQHGVLVKIIRIFNTYGPNML
TDDGRVISNFVVQALLDKDITIYGDGKQTRSFQYIDDLVEGMIRMMATEDHFTGPVNIGN
PCEFSIFELAQKILELTCSHSNIIFEPLPHDDPRQRRPDITLAKEKLDWEPHIHLEEGLT
KVIDYFKSVLAK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatcctagtaacgggaggcgcaggatttatagggtcacatctatgcactcgt
ctgatagaggaaggtaatattgttatatgtttagacaactttttcacggggagtaaagag
aatataagttacctgaccgggcatccgcgctttgaactgatagaacacgatataattaat
ccgttttggacggatgtggacgagatatacaatctggcatgtcccgcctctcctatacat
tatcagcatgatgctatcaaaacggcgaagacggctgtcttcggcacgtttaatatgttg
ggactggcgaagcgtaacaaagcaaaaatacttcaggcttctaccagtgaggtgtatggt
gatccgttgtcgcatccccagagggagggagattgggggaatgtgaatcccataggctac
cggtcttgttatgatgaaggaaaacgttgtgccgagactttgtgcatggattattaccgt
caacatggcgttttggtaaaaataatccgcatattcaatacgtatggtcctaatatgctg
accgatgacggacgtgtaatttccaattttgtggtacaggcattgctagataaagatata
accatttatggagacggaaaacagacacgtagttttcagtacatagatgatctggtggaa
gggatgatacgtatgatggctacggaagatcacttcacaggaccggtgaatatcggtaac
ccttgcgaattttccatattcgaactggctcagaagatattggaactgacctgttctcat
tctaacattattttcgaacctttacctcatgatgaccctcgtcagcgcaggccggatatt
actctggcaaaagaaaagctggattgggagcctcacattcatctggaagaggggctgacg
aaagtgattgattattttaaaagtgttctggctaaataa

DBGET integrated database retrieval system