KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_22145Help
Entry
GV66_22145        CDS       T03263                                 

Definition
(GenBank) type I restriction modification protein
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bdh02048]
    GV66_22145
Enzymes [BR:bdh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     GV66_22145
Prokaryotic defense system [BR:bdh02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   GV66_22145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S
Motif
Other DBs
NCBI-ProteinID: AII70197
Position
complement(5218798..5220108)
Genome map
AA seq 436 aa AA seqDB search
MDTKALRQKILDLAIHGKLVPQDPNDEPASVLLERIKAEKERLIKEGKIKRSKKSAKSSD
TPHYENVLPDGWCLTDIGELLINRDGERKPVSSVIRSKQTSKIYDYYGAAGVIDKVDSYL
FDERLLLIGEDGANLLSRSKNNAFFAEGRYWVNNHAHVLDATDKNLLDFIAIVINSMKLD
DYITGSAQPKLSQDNLNKIPIVLPPLAEQQRIIAEIKKWFTLIDQIEQGKADLQTTIELT
KSKILDLAIHGKLIPQDPNDEPAIELLKRINPDFTPCDNGHYTQLPEGWAICKMKQITSI
TNGKSQKNVETLNGIYPIYGSGGVIGRANQYLCIAGSTIIGRKGTINNPIFVEEHFWNVD
TAFGLKANDAILDKYLYYFCLSFDFSKLDKSTAMPSLTKTSIGNVLIPIPPYKEQERIVA
KIDMVLDTMNEILRAV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaagcgttacgtcaaaagatactcgaccttgcgatacatggaaaacttgta
ccccaagatcccaacgatgaaccagcatcagttctgctcgaacgaatcaaggctgaaaaa
gaacgactgataaaagaaggcaaaatcaaacggagtaagaagtctgcaaagtcttccgat
acgccccattatgagaacgtattaccagatggatggtgtttgacagatataggagaactt
ctgattaatcgtgacggtgaaaggaaacctgtctcgtcagtgatacgtagcaagcaaacg
agtaaaatttatgattattacggtgcagcaggggtaatagataaagtggatagttatctt
tttgatgaaagattgcttcttataggagaagatggtgctaatttattatcaagaagtaaa
aataatgcattcttcgcagaaggaagatattgggtcaataatcatgctcatgtgttggat
gctacagataaaaacttacttgactttatcgcaattgttatcaactcaatgaaactggac
gattatattacggggtcagcccaacccaagttgtcacaagataatttgaataagattcca
attgttttacctccattagctgaacaacaacgtataattgcagaaataaaaaagtggttt
actttaattgaccaaatagaacaaggcaaagccgatttacagaccaccattgaactaaca
aaaagcaaaattctcgaccttgccattcacggaaagctcataccgcaagatccgaatgac
gaaccagccattgaactattgaagcgcataaatcccgacttcacaccttgtgataacggg
cattatacacagttgcctgaaggatgggctatttgtaaaatgaaacagattacaagtata
acgaatgggaagtctcaaaaaaatgttgaaacacttaacggtatatatccaatttatggt
agtggcggtgttataggtagagctaatcagtatctttgcatcgcaggttctacaataatt
ggaagaaaaggtacaattaataatcctatattcgtagaggaacatttttggaacgttgat
acagcttttggcttgaaggctaatgatgctatacttgataaatatctgtattatttctgc
ttatcatttgattttagcaaattagataaaagtacggctatgcccagtttaacaaaaaca
tctattggtaatgttttaatacccataccgccatataaagagcaagaacgaattgtggct
aaaatagatatggtgcttgatacgatgaatgaaatattacgggctgtataa

DBGET integrated database retrieval system