KEGG   Brachypodium distachyon: 100821046Help
Entry
100821046         CDS       T01717                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bdi  Brachypodium distachyon
Pathway
bdi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100821046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bdi03041]
    100821046
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100821046
Spliceosome [BR:bdi03041]
 Complex C
  Other components
   Step II factors
    100821046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 DUF2075 T2SSE FtsK_SpoIIIE NB-ARC DAP3 ABC_tran
Motif
Other DBs
NCBI-GeneID: 100821046
NCBI-ProteinID: XP_010237672
UniProt: I1IL91
Position
4
AA seq 697 aa AA seqDB search
MPSFSSGASPQKQQHNARRKQLIRQQRKSLPIASVKKRLVEEVKKNDTLIVVGETGSGKT
TQLPQFLYDAGFCQDGKVIGITQPRRVAAVTVAKRVAEECNDQLGKKVGYSIRFDDSTSN
ATRIKYMTDGLLLREALLDPLLSKYSVIVVDEAHERTVHTDVLLGLLKKVQRSRSICADK
NGKTSSDRQDHSQSSTLKACQGIKYAPLKLIIMSASLDAKCFSDYFGGAKAVHIQGRQYP
VDTLYTYQPESDYLDATLVTIFQIHLEEGPGDILAFLTGQEEIESLERLIQERARQLPPD
STKIWTTPIYSSLPSEQQMNAFKPAQAGARKVVLATNIAETSVTIPGIKYVIDPGMVKAR
AYNPVTGMESLIIIPVSKAQALQRSGRAGREGPGKCFRLFQECEFDKLAESTVPEIKRCN
LSNVVLQLKALGIDDIIGFDFMEKPSRTSILKSLEQLILLGALTDDYKLSDPVGKQMARL
PLDPMYSKALIVSNEFKCLEEMLIVVSMLSVESIFFTPREKLEEARAARKSFESSEGDHI
TLVNVYRAALECLEKSKSANAKEKTMEKALNRWCWENFINYRSLRHARDVHSQIQGHVQQ
MGLYVSSCGDDMVQFRRCLTAAFFLNAAMRQPDGSFRALATGQSVQMHPSSVLFRTKPDC
VIFNELVRTTQNYVKNLSRIDPLWLAELAPQYYATED
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccttctcttcgggcgcttctccgcagaagcagcagcataacgcgcggaggaag
cagctgattcgtcagcagaggaaatcgcttcccatcgcgtcagtgaagaaaaggcttgtc
gaggaggtcaagaagaatgacactctgatcgtcgtcggtgagaccgggagtggcaaaacg
actcagttgccacaatttttgtatgatgctgggttttgtcaggatggaaaagtcattggg
atcactcagcctcgaagagttgcagccgttacagtagcaaaacgtgttgctgaggaatgc
aatgatcaattgggcaaaaaagtcggatactctattcgatttgatgattccacatctaat
gcaacaaggattaagtacatgaccgacggtttgcttctaagggaagcacttcttgatcct
ttattgtctaagtatagtgttatagttgttgacgaagcccacgaaagaacagtccataca
gatgtcttgctgggtttgttgaaaaaagtccaacgttccagatctatctgtgccgataaa
aacggaaagacttcgtctgacagacaagatcactctcaaagttctactctaaaggcatgc
cagggaataaaatatgcacctctaaagcttataattatgtctgccagtttggacgccaag
tgtttttctgactattttggtggcgctaaagctgtacatatccaaggacggcaataccct
gttgatacactgtatacttatcagcccgagtcggattatctagatgctacactagttaca
atatttcagatccatttggaggaaggacctggagacattcttgcatttttaactggccaa
gaggagattgaatcactagagagacttattcaggagcgtgctcgtcaacttccacctgat
agtaccaagatatggactacacctatctactcatctcttccatcagagcagcaaatgaat
gcttttaaaccagcacaagctggagcccgcaaggtagttctagcaacaaatattgcagag
acttctgtaacaatacctggtattaaatatgttattgatcctgggatggtcaaagcacgc
gcctacaatcctgttactggaatggagtcccttatcatcatcccagtctctaaagcacag
gctcttcaaaggagtggccgtgctggacgggaggggccagggaagtgcttccgattattc
caagaatgtgagtttgataaactggcggaatctacagttcctgagattaagcgatgtaac
ctctcgaatgttgtactacagctcaaagctcttggaattgatgacatcataggttttgat
ttcatggagaaaccatccaggacatccattttgaaatcattggagcagttgattttacta
ggagctttgactgatgattataagctctcagatccagttggtaaacagatggctaggctg
cctttggatccaatgtactccaaggcattgatagtatcaaacgaattcaagtgcttggaa
gaaatgttgatagttgtttctatgctttcagtggaatcaattttcttcaccccacgcgag
aagttagaagaggcaagagctgctaggaagagttttgaaagctctgaaggagaccatata
actttggtgaatgtatatcgagctgctttggaatgcttggaaaagagcaaaagtgcaaat
gccaaagaaaagacaatggagaaggctctgaacagatggtgctgggaaaacttcatcaat
taccgctctttaagacatgctcgtgatgttcacagtcaaattcagggccacgtccaacag
atggggctttacgtgtcatcttgtggagatgacatggttcagtttcggagatgcctcact
gctgctttcttcttgaatgcagcaatgcgacagccagacggatcattcagggctcttgca
accggtcagagcgtgcagatgcatccttcgtcggtgctcttccggaccaagccggactgc
gtcatcttcaacgagctggtccggacaacccagaactacgtcaagaacctgagccggatt
gatcccctgtggcttgctgaactcgccccgcagtactacgccactgaggactga

DBGET integrated database retrieval system