KEGG   Brachypodium distachyon: 100822242Help
Entry
100822242         CDS       T01717                                 

Definition
(RefSeq) probable mannan synthase 4 isoform X1
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bdi01003]
    100822242
Enzymes [BR:bdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     100822242
Glycosyltransferases [BR:bdi01003]
 Polysaccharide
  Structural polysaccharide
   100822242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 100822242
NCBI-ProteinID: XP_010234713
UniProt: I1I3U8
Position
3
AA seq 527 aa AA seqDB search
MAPLGADAVAAAWAALRARAVAPMLRAAVWACLVMSVMLVVEAACMSLVSLVAVRLLRRR
PERRYKWEPMPGAAVGDDVEDPPLDCGEFPRVLVQIPMYNEKEVYKLSIGAACALTWPPD
RIIIQVLDDSTDPLIKELVELECQDWASKKININYEVRDNRKGYKAGALKKGMEHIYAQQ
CDFIAIFDADFQPESDFLLKTIPFLVHNPKIALVQTRWEFVNYGVCLMTRIQKMSLDYHF
KVEQESGSFMHAFFGFNGTAGVWRVSAINESGGWKDRTTVEDMDLAVRAGLKGWEFLYVG
DIRVKSELPSTFKAYRHQQHRWTCGAANLFRKMAWEIVTNKGVSIWKKYHLLYSFFFVRR
VIAPILTFLFYCIVIPLSAMVPEVSIPVWGLVYIPTAITIMNAIRNPRSLHLMPFWILFE
NVMSLHRMRAALTGLLETAHANDWVVTEKVGDLVKDDLDIPLLEPLRPTECVERIYVTEL
LLAFYLLICASYDFVLGSHTYYMYIYLQAFAFVILGFGFVGTKTPCS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgctcggcgccgacgcggtcgcagcggcgtgggcggcgttgcgggcgcgcgcg
gttgccccgatgctgcgggcggcggtgtgggcgtgcctcgttatgtcggtcatgcttgtc
gtcgaggccgcctgcatgagcctcgtcagcctcgtggccgtccggttgctgcgccggcgc
cccgagcggaggtataagtgggagccgatgcccggggccgcggtgggggacgacgtggag
gatcctccgctggattgcggcgagttcccgagggtgctcgtgcagatccccatgtacaac
gagaaggaggtgtataagctgtccattggagctgcgtgtgctctcacatggccaccagat
cgtattataatccaagtcttggatgattccacagatccactaatcaaggaactagttgag
ctcgaatgccaggactgggccagtaagaaaatcaacatcaactatgaggttagagataac
aggaagggatacaaagcaggagccttgaagaaaggcatggaacacatatatgcgcaacag
tgtgatttcattgctatcttcgatgcagattttcaacctgaatctgacttcctgttgaaa
actataccatttcttgtgcataatccaaagattgcacttgtgcaaacacgttgggaattt
gtgaactatggtgtttgcttgatgacgaggatacagaagatgtcactggactatcatttc
aaagtcgagcaggaatctggttcatttatgcacgcattctttggtttcaatggcacggct
ggtgtttggcgtgtatctgctattaatgaatccggaggatggaaagatcgcaccactgtg
gaggacatggacttggctgtacgggcaggcctcaagggatgggagttcttgtatgtgggt
gatataagggtcaagagtgaactgccaagtacattcaaggcctatcgtcatcaacagcat
aggtggacttgtggtgctgccaatctcttcagaaaaatggcatgggaaatcgtgacaaac
aagggggtgtcaatatggaagaaatatcaccttttatacagcttcttctttgtgcggagg
gtcattgctcctatcctgacattcttattctactgtattgttattccattatctgccatg
gttcctgaagttagtattcctgtatggggcctggtctacattcctactgcaattaccatc
atgaatgccattagaaatcctcggtcgctccatctgatgcccttctggattttgtttgaa
aatgtaatgtccctgcaccgtatgcgtgcagctctaactggtttacttgagactgcacat
gcaaatgattgggtggttaccgaaaaggtaggagatctggtgaaggatgatcttgatata
ccactcctggaaccactaaggcccactgaatgcgtggagaggatttacgtcactgagctc
ttgcttgcgttctacctcttgatatgtgcctcgtatgatttcgttcttggaagccataca
tactacatgtacatctaccttcaggcctttgcatttgtcatattggggtttggttttgtt
ggaacaaaaactccatgttcatag

DBGET integrated database retrieval system