KEGG   Brachypodium distachyon: 100822828Help
Entry
100822828         CDS       T01717                                 

Definition
(RefSeq) tyrosine decarboxylase 1 isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00350  Tyrosine metabolism
bdi00360  Phenylalanine metabolism
bdi00380  Tryptophan metabolism
bdi00950  Isoquinoline alkaloid biosynthesis
bdi00965  Betalain biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100822828
   00360 Phenylalanine metabolism
    100822828
   00380 Tryptophan metabolism
    100822828
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    100822828
   00950 Isoquinoline alkaloid biosynthesis
    100822828
   00965 Betalain biosynthesis
    100822828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdi04147]
    100822828
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100822828
    4.1.1.105  L-tryptophan decarboxylase
     100822828
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100822828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 100822828
NCBI-ProteinID: XP_010238981
UniProt: A0A0Q3H064
Position
1
AA seq 498 aa AA seqDB search
MDGSTTSNGGGGWMRPMDEEQLRECGHRMVDFIADYYKSIETYPVLSQVQPGYLKELLPD
SAPNQPDTLDALFDDIREKIVPGVTHWQSPNYFAYYPSNSSTAGFLGEMLSAAFNIVGFS
WITSPAATELEVIVLDWVAKMLKLPSEFLSAALGGGVIQGTASEAILVVLLSARDRTLRK
HGKKSLEKIVVYASDQTHSALKKACQIAGIFPENIRIVKADCSMNYAVTPGAVSEAISID
LSAGLIPFFICATVGTTSSSAVDPLHELGQIAQAHDMWFHIDAAYAGSACICPEYRKYLN
GVEEADSFNMNAHKWFLTNFDCSLLWVKDRNYLIQALSTNPEFLKNKASQENSVIDFKDW
QIPLGRRFRSLKLWMVLRLYGVENLQSYIRKHIQLAQHFEQLVISDPRFEVVTPRNFSLV
CFCLVPPTCEVDNGHKLNYDLMDSANSSGKIFISHTVLSGKFVLRFVVGAPLTEEQHVDA
AWKLLQDEATKLLGNVVQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggacggtagcactaccagcaatggcggcggcggttggatgcggccgatggacgaggag
cagctgcgggagtgcggccaccggatggtggatttcatcgccgactactacaaatccatt
gagacctatcccgtccttagccaagtccagccaggatatctaaaggaacttcttccagat
tcagctccaaaccaacctgatactttggatgccctttttgatgatattcgggagaagata
gtaccgggagtaactcattggcaaagtccaaattattttgcttactatccttcaaatagc
agcaccgctggattcctgggggagatgcttagtgctgcatttaacattgttggatttagt
tggataacctctcctgctgcaacagagctagaggttatagtcttagactgggttgcaaaa
atgcttaagcttcctagcgagtttctatcagctgcacttggtggaggagtaatccagggt
accgccagtgaagccattcttgttgtactattgtctgcacgagatagaactttaaggaag
cacgggaagaaatcccttgaaaaaatagtagtttatgcatctgatcaaacacattctgct
ctgaaaaaggcatgccagattgctggaattttcccagaaaacatccgaattgtgaaggct
gactgtagtatgaactatgctgttacaccaggagcagttagcgaggccatctccatagat
ttgtcagctggtttgataccattcttcatctgtgcaacggttggtacaacatcttcatcg
gcagtggaccccttgcatgaactaggacagatagcacaggcccatgacatgtggttccat
attgatgctgcatatgctggaagtgcttgtatatgcccagagtaccgaaaatacctcaat
ggagtggaagaagctgattcatttaatatgaatgcacataaatggttcctcacaaatttc
gactgttccttgctttgggttaaagataggaattatctcatacaagcattgtctacaaat
ccagagtttcttaagaataaggcttcccaagaaaattctgttattgacttcaaagattgg
cagattccacttggccgtcgttttagatcactgaagctatggatggtattgaggctttat
ggcgtggaaaacctacagagctatatcagaaagcacatccagttggctcaacattttgaa
caacttgtaatatctgatccaagatttgaggtagtaactccgaggaatttttcccttgtt
tgtttctgccttgtgcccccaacttgtgaggtcgacaatggccataaacttaactatgac
ctaatggatagtgcgaactcaagtggcaagatcttcatatcacatacggttctttctggc
aagtttgtgttgagatttgtagttggagcaccgttgacagaggagcaacatgtagatgcc
gcttggaagcttttgcaagatgaggccaccaagctattaggaaatgttgtacagtag

DBGET integrated database retrieval system