KEGG   Brachypodium distachyon: 100827410Help
Entry
100827410         CDS       T01717                                 

Definition
(RefSeq) probable glutathione peroxidase 4
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00480  Glutathione metabolism
bdi00590  Arachidonic acid metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100827410
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100827410
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100827410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin MetOD2
Motif
Other DBs
NCBI-GeneID: 100827410
NCBI-ProteinID: XP_003557888
UniProt: I1H5A5
Position
1
AA seq 198 aa AA seqDB search
MGATESVPETSVHEFTVKDCNGKEVCLEMYKGKVLLIVNVASKCGFTETNYTQLTDLYQK
HRDKDFEILAFPCNQFLRQEPGSDQQIKDFACQRFKAEYPVFQKVRVNGPDAAPLYKFLK
ASKPGLFGSRIKWNFTKFLVDKNGKVINRYATATTPFAFEKDILKALEEVPNLQKDTPKA
SEEVPDLLKDTPKAPESE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgacggaatccgtgcctgagacctctgtacacgaattcaccgtcaaggattgc
aacggcaaggaggtgtgtctggagatgtacaaggggaaggtcctcctcatcgtcaacgtc
gcctccaaatgcgggtttacagagaccaattacacgcagctgacagatctttatcagaag
cacagggataaagactttgaaatattagcattcccctgcaaccagttcttacgacaagag
ccaggcagtgaccagcagataaaagactttgcttgccaacgattcaaagctgaatatcca
gtttttcagaaggtgcgcgtaaatggcccggatgctgcaccactttacaagtttcttaaa
gccagcaaacctggtttgtttggttcaagaatcaaatggaactttaccaagtttcttgtt
gataagaatggaaaagtcatcaacagatatgcaactgcaaccactccatttgcatttgag
aaagatatcctgaaggcacttgaggaggttccaaatttgcagaaagacaccccgaaggca
tctgaggaggtcccagatttgctgaaagacaccccgaaggcacccgagtcggaatag

DBGET integrated database retrieval system