KEGG   Brachypodium distachyon: 100827673Help
Entry
100827673         CDS       T01717                                 

Definition
(RefSeq) protein disulfide isomerase-like 2-2
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100827673
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100827673
Chaperones and folding catalysts [BR:bdi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100827673
Membrane trafficking [BR:bdi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100827673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 OST3_OST6 Thioredoxin_2 AhpC-TSA Thioredoxin_8 Thioredoxin_6 Thioredoxin_7 Redoxin TraF HyaE DUF836 Thioredoxin_9 DctP
Motif
Other DBs
NCBI-GeneID: 100827673
NCBI-ProteinID: XP_003567659
UniProt: I1HF62
Position
2
AA seq 367 aa AA seqDB search
MAIRQISRQTLALLFVVAAASFAALVFADGDDVVVLTEGTFEKEVGQDRGALVEFYAPWC
GHCKKLAPEYEKLGASFKKARSVMIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKK
YEGQRTAEALAEFVNKEGGTNVKLATIPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCG
HCKHLAPIYEKLASAFKLDDGVVIANVDADKYKDLGEKYGVTGFPTLKFFPKGNKAGEDY
DGGRDLGDFTKFINEKCGTSRDTNGQLTSEAGRIASLDTLAKEFLSVASDKRKEVLSSIE
EEVAKLSGSAAKHGKVYVTIAKKILDKGNDYTKKETERLHRILEKSISPSKADEFIIKKN
VLSTFSS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccgccagatctcccgtcaaaccttggccctcctcttcgtcgtcgccgccgcc
tcctttgcggccctggtgttcgccgacggagacgacgtggtggtcctcacagagggcacc
ttcgagaaggaagtcggccaagatcgcggcgccctcgtcgagttctacgctccctggtgt
ggtcactgcaagaagcttgcccctgaatatgaaaagcttggtgcaagtttcaagaaagcc
agatctgtcatgattgcaaaggttgattgtgatgagcacaagagtgtgtgcagcaagtat
ggagtttcagggtatccaacaatccaatggttccccaaaggttccttggagcccaaaaag
tatgagggacagcgcactgcagaagcccttgctgaatttgttaataaagaaggaggtacc
aatgtaaagctggcaaccattccttcaagtgttgtagtgctcacacctgagacctttgac
tcagttgtccttgatgaaacaaaagatgttcttgtggagttttatgccccatggtgtggc
cactgcaagcatcttgctccgatatatgagaagctagcttctgctttcaagttggatgat
ggagttgtgattgctaacgttgatgctgacaaatataaagacctgggtgaaaagtatgga
gttactggttttcctaccttgaagttcttcccaaagggaaacaaagctggtgaagattat
gatggcggcagggacttgggtgacttcaccaaattcattaacgagaagtgtggtaccagc
cgtgatacaaatggtcaactcacttccgaggctggacgtatagcaagtttggataccctg
gcaaaggagttccttagtgttgccagtgacaagcggaaggaagtcctgtccagtatagaa
gaggaagttgccaagctcagtggttctgctgcaaagcatggaaaggtctatgttacaatt
gcaaagaagatcctggacaaaggtaacgactatactaagaaagaaactgagaggcttcac
cgtatattggagaagtccatcagcccttcaaaggcagatgaatttatcataaagaagaat
gttctttcaacattctcttcttaa

DBGET integrated database retrieval system