KEGG   Brachypodium distachyon: 100828003Help
Entry
100828003         CDS       T01717                                 

Definition
(RefSeq) tryptophan synthase beta chain 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00260  Glycine, serine and threonine metabolism
bdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01230  Biosynthesis of amino acids
Module
bdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100828003
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100828003
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100828003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 100828003
NCBI-ProteinID: XP_003573351
UniProt: I1I0S0
Position
3
AA seq 468 aa AA seqDB search
MAASAIRNPSPASAAAVAASRSAVSTSRSILRVPAASRRSLVVAAGMRPAKAVAAEAPTP
VAERVNGAEVARPDAMGRFGKFGGKYVPETLMHALTELEAAFHALADDQDFQTELDGILK
DYVGRESPLYFAERLTEHYKRADGTGPLIYLKREDLNHTGAHKINNAVAQALLAKRLGKQ
RIIAETGAGQHGVATATVCARFGLQCVIYMGAQDMERQALNVFRMRLLGAEVRAVHAGTA
TLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVREFHKVIGKETRRQAMDKWGGKP
DVLVACVGGGSNAMGLFHEFVDDQDVRLIGVEAAGHGVDTDKHAATLTKGEVGVLHGSLS
YVLQDADGQVIEPHSISAGLDYPGVGPEHSFLRDIGRAEYDSVTDQEALDAFKRTSRLEG
IIPALETSHALAYLEKLCPTLPDGVRVVLNCSGRGDKDVHTASKYLDV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcggctatcaggaaccctagccccgcctccgcagccgccgttgccgcgtcg
aggtcggcggtgtccacctcgcgctcgatcctgcgggttccggcggcatcgaggaggagc
ctggtggtggcggcgggaatgcggccggcgaaggcggtggcggccgaggcgccgacgccc
gtggcggagcgggtgaacggggcggaggtggccaggcccgacgcgatggggaggttcggc
aagttcggggggaaatacgtgcccgagacgctcatgcacgcgctcaccgagctcgaggcc
gccttccacgccctcgccgacgaccaggacttccagaccgaacttgatggtatcctcaag
gattacgtcggccgcgagagccctctgtactttgctgagcgcctgacggagcactacaag
cgtgctgatggcactggcccgctgatttacctcaagagggaggaccttaaccacaccggt
gcccacaagatcaacaatgctgtggctcaagctctgcttgccaagcggctcgggaagcag
cgtatcatcgctgagactggggctggccagcatggagttgccactgccacggtgtgtgct
cgctttgggctgcagtgtgtcatctacatgggtgcgcaagatatggagaggcaggcgctt
aacgttttcaggatgaggcttcttggagctgaggtaagggcagtacatgctgggactgct
actctgaaggatgctacctcggaggccatccgtgattgggtcactaacgtagagaccaca
cactacatcttgggctcagttgctggaccgcacccatacccgatgatggtgagggagttc
cacaaggtgattggcaaggagacccgtagacaggcaatggacaagtggggcggcaagcct
gatgtgttggttgcttgcgttggtggtggatcaaatgccatggggctcttccatgagttt
gttgatgaccaagacgtgagactgattggagtggaggctgctggtcatggtgtagacact
gacaaacatgctgcaactttgacaaagggcgaggtcggagttctccatggatctctgagt
tatgtattgcaggatgccgatggacaagtcattgaaccccactctatcagcgctgggttg
gattaccctggtgttggacctgagcacagtttcttgagggatattggacgtgctgaatac
gacagtgtgacagaccaggaggcattggacgctttcaagcgcacctctcggctggagggc
atcatccctgccctggagacgtcccatgcgctcgcctacctcgagaagctctgcccgacg
ctccctgatggggtgagggtggtgctgaactgcagtggaagaggagacaaggatgtccac
acagccagcaagtacctcgatgtctaa

DBGET integrated database retrieval system