KEGG   Brachypodium distachyon: 100829255Help
Entry
100829255         CDS       T01717                                 

Definition
(RefSeq) uncharacterized protein LOC100829255
  KO
K02890  large subunit ribosomal protein L22
Organism
bdi  Brachypodium distachyon
Pathway
bdi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100829255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bdi03011]
    100829255
Ribosome [BR:bdi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    100829255
  Bacteria
    100829255
  Archaea
    100829255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 100829255
NCBI-ProteinID: XP_003580511
UniProt: I1J1K7
Position
5
AA seq 276 aa AA seqDB search
MVGWRAAGVRAVLRRLGAAAAEKPDCRVFAARYSSSTSSCANAPFRLGQYTNLLRTHNST
SRGIPANFHQLIRNAGISTTRNLLAADDAMVPVSSPLTPPLGDAGEPDKKGAVVKRLKVQ
AIKKDIKQSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTLYQVIHSARANAAHNHGL
DAEKLIVEEAFVGKGLYLKRLSYHAKGRCGVMVRPRCRLTVVVREATAEEEAKIAKLRVS
NYKKLTRKEKQLMPHRLIEVSPRWARKRKVETGVTA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggtaggctggcgggcggcgggcgttcgtgccgttcttcgccggctcggcgcggcggcg
gcggagaaaccggattgccgtgtgttcgcagcgagatatagcagcagcacgagcagctgc
gcgaatgctccatttcgcttgggccaatacacaaatttgttgaggacacacaattctacc
tccagggggattccagcgaactttcatcagctgatccgcaatgctggaatatcaaccaca
aggaacttacttgctgcagatgatgctatggttcccgtttcttctcctttgacacctcca
ctgggggatgcaggagagcctgacaaaaagggagcagtggttaagcgactgaaagtccaa
gccataaagaaggatatcaagcagagccccaagaaggtgaatctggtagccaagctagtt
cgaggaatgcgtgtggaagacgcccttttgcagctgcaagtgacagttaaaagggctgca
aaaactttgtaccaggtgattcattctgctcgtgccaatgcagctcacaaccatggattg
gatgctgagaaacttattgtggaagaggcctttgtgggaaaagggctttatcttaagagg
ttgtcttaccatgccaaagggaggtgtggtgtcatggtgagacctaggtgcagactgacg
gtggtagttagagaagctacggctgaggaagaagcaaagattgctaaactcagagttagc
aactacaaaaagctcacccgaaaggagaagcagctcatgcctcaccggcttattgaggtt
agcccaaggtgggctcgcaaaaggaaagtggagactggtgttacagcataa

DBGET integrated database retrieval system