KEGG   Brachypodium distachyon: 100830469Help
Entry
100830469         CDS       T01717                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00040  Pentose and glucuronate interconversions
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi00520  Amino sugar and nucleotide sugar metabolism
bdi01100  Metabolic pathways
Module
bdi_M00361  Nucleotide sugar biosynthesis, eukaryotes
bdi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100830469
   00052 Galactose metabolism
    100830469
   00500 Starch and sucrose metabolism
    100830469
   00520 Amino sugar and nucleotide sugar metabolism
    100830469
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100830469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100830469
NCBI-ProteinID: XP_003578601
UniProt: I1ISL8
Position
4
AA seq 475 aa AA seqDB search
MAATAVAAAADTKIEKLREAVAKLDEISENEKAGFISLVSRYLSGDADQIEWSKIQTPTD
EVVVPYDTLAPAPEDLDATKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLI
VIQIESLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIDIHIFNQSQYPRIVTEDFL
PLPSKGQTGKDGWYPPGHGDVFPALNNSGKLDTLLAQGKEYVFVANADNLGAVVDIKILN
HLIHNQNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNT
NNLWVNLKAVKRLVEADKLKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGANVPRS
RFLPVKATSDLLLVQSDLYTLVDGYVIRNPARVKPSNPSIELGPEFKKVANFLARFKSIP
SIVELDSLKVSGDVLFGSGVILKGKVTITAKPGVKLEIPDGAVLENKDINGPEDL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccgccgttgctgccgccgccgacacgaagatcgagaagcttcgcgaggcc
gtcgccaagctcgacgaaattagcgaaaacgagaaggccgggttcatcagcctcgtgtcg
cgctacctcagtggcgatgcggatcagatcgagtggagcaagatccagaccccgaccgat
gaggtggtggtgccgtacgacaccctagctccggctcccgaagatctcgacgctacgaag
gctctgctcgacaagctcgtggtgctcaagctcaacggtgggctcgggacgaccatgggc
tgcactggtcccaagtctgtcattgaagttcgcaacgggtttacatttcttgaccttatt
gtgattcaaattgagtccctgaacaagaagtatggatgcaatgtccctttgcttctgatg
aactctttcaacactcatgatgatacacaaaagattgttgagaagtactccaactccaac
attgacattcacatttttaatcagagccaatatccccgcattgttactgaagacttcttg
ccacttccaagcaaagggcagacagggaaggatggctggtatcccccaggccatggtgat
gtgttccctgctttgaacaatagtggaaaacttgataccttattggcacagggaaaggag
tatgtcttcgtcgcgaacgcagataacttgggtgcagtagttgacatcaagatactaaac
cacctgatccataaccagaacgagtactgcatggaggttaccccaaaaacattggctgat
gttaaaggtggtaccctcatatcatatgaaggaagggtccagctcttggagattgcccaa
gtccctgatgagcatgtgaatgaattcaagtcaatcgagaagttcaagatattcaatacc
aacaacttgtgggtgaacttgaaggcagtcaagaggcttgtagaagctgacaaactcaag
atggaaatcattcccaaccctaaggaagttgatggtgtgaaagtcctacaactcgaaact
gcagctggggccgcgatacggttcttcgagaaagcaatcggtgctaacgttccccgctca
aggtttctgcctgtgaaggctacatctgatttgttgcttgtgcagtctgatctttatacc
ttggttgatggctacgtcatccgcaaccctgctagagtcaagccatcaaacccttcaatt
gagcttggtcctgagttcaaaaaggttgctaacttccttgcccgattcaaatcgatccca
agcattgttgagcttgacagcttgaaggtctctggtgatgtcttgtttggctctggcgta
atcctcaagggcaaggtgaccatcactgcgaagcctggagtcaagctggagattccagac
ggagctgtgcttgagaacaaggacatcaacggcccagaggatctttga

DBGET integrated database retrieval system