KEGG   Brachypodium distachyon: 100830484Help
Entry
100830484         CDS       T01717                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 7
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100830484
   00500 Starch and sucrose metabolism
    100830484
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100830484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 100830484
NCBI-ProteinID: XP_003580762
UniProt: I1J321
Position
5
AA seq 619 aa AA seqDB search
MAGFFPLAVCAVAFHLCLLLCSSSSLRVAPESSRSSSPARHGGGKRIRTAYHFQPAKNWQ
NDPNGPMYHNGVYHFFYQYNPGGATWGTGNLSWGHSVSGDLVNWLALAPALVPGSPFDAN
GCWSGSATVLPGGIGPAFLYTGIDAAGDQVQNVAFPKDPSDPLLRDWVKPAYNPVIPLPS
GVPGDSFRDPSTAWVGRDGLWRVAVSAAVVGGEGGGSTLVYRSKDFRRWERNPAPLHASG
KAGMVECPDLFPVAAPGHEEGLDLSSSSPAAGAARHVLKLSVMDTLQDYYAVGVYDDAAD
TFTPVEEDGEDCRSWRRFDYGHVYAAKSFFDAGKRRRVLWAWANESDSQADDIARGWSGV
QIFPRKVWLDADGKQLRQWPVEEIETLRIPNNRRAGLLPGADQVNAGGLNEIVGVAGAQA
DVEAVFEVPALENAESLDDDHSNWLLDPQRLCGEKGASVRGGVGPFGLLVLASGDLHEHT
AVFFRVFRYQGKYKTLMCTDLTRSSTRAGVYKPAYGAFVDMDIEEHGAVISLRTLVDHSV
VESFGAGGRTCMTARVYPEETTAGNGEESRLYVFNNGTGAVKVARLEAWELATASVNVVT
VGDDGGSILLGSMRASEAE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggccggattcttccctctggccgtctgcgccgtggccttccacctctgccttctcctc
tgttcgtcttcgtctctccgggtagcccccgagagctcgagatcgagctcgccggcccgc
catggcggtggcaagaggatcaggaccgcctaccacttccagcccgccaagaactggcag
aacgatccgaatgggccaatgtaccacaacggggtgtaccacttcttctaccagtacaac
cccggcggcgcgacctggggcacggggaacctctcctggggccactccgtctccggcgac
ctggtcaactggctcgccctcgcccccgccctcgtcccgggctcccccttcgacgccaac
ggctgctggtcgggctccgccacggtcctccccggcgggatcggccccgccttcctctac
accggcatcgacgccgccggggaccaggtccagaacgtcgccttccccaaggacccctcc
gacccgctcctccgcgactgggtcaagccggcgtacaaccccgtcatccctctcccttcc
ggcgtcccgggcgacagcttccgtgacccttccacggcgtgggtcggccgcgatgggctc
tggcgcgtcgccgtgtccgccgccgtggttggaggagaaggcggggggtcgacgctggtg
taccggagcaaggatttccggcggtgggagcggaacccagcgccgctgcacgcgtctggc
aaagctggcatggtcgagtgcccggatctgttccccgtggccgcgcccggccacgaggaa
gggctcgacctttcgtcttcgtctccggcggcgggggcggcgaggcacgtgctgaagctg
agcgtgatggacacgctgcaggactactacgcggtgggggtgtacgacgacgcggcggac
accttcacgccggtggaggaggacggcgaggactgccggagctggcggcggttcgactac
ggccacgtgtacgcggccaagtccttcttcgacgccgggaagcgccgccgcgtgctctgg
gcctgggccaacgagtccgactcgcaggccgacgacatcgcccgaggctggtccggcgtc
cagatcttcccgaggaaggtgtggctcgacgcggacgggaagcagctgcggcaatggccg
gtggaggagatcgagacactcagaatccccaacaacagacgtgccgggctattgcctgga
gcggaccaggtgaacgccggcggcttgaacgagatcgtgggcgtggcgggcgcccaggcg
gacgtggaggccgtcttcgaggtcccggcgctggagaacgccgagagcctggatgatgat
cactccaactggctgctggacccgcagaggctgtgtggggagaaaggcgcgtcggtgcgc
ggcggcgtcggccccttcgggctcctcgtcctcgcctccggtgacctgcacgagcacacc
gccgtcttcttccgggtgttcagataccagggcaagtacaagaccctcatgtgcaccgac
ctcacgaggtcgagcacgagagccggggtgtacaagccggcgtacggcgcgttcgtggac
atggacatcgaggagcacggggccgtgatatcgctcagaaccttggttgatcattcggtg
gtggagagcttcggggccgggggccggacgtgcatgacggcgcgggtgtacccggaggag
acgacggcgggcaacggcgaggagagccggctgtacgtgttcaacaacgggacgggcgca
gtgaaggtggccaggctcgaggcgtgggagctggcgacggcgtccgtcaacgtcgtcacg
gtcggggacgacggcgggtcgatccttctgggatccatgcgcgcaagtgaagccgagtag

DBGET integrated database retrieval system