KEGG   Brachypodium distachyon: 100830606Help
Entry
100830606         CDS       T01717                                 

Definition
(RefSeq) NADH--cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100830606
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100830606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100830606
NCBI-ProteinID: XP_003564467
UniProt: I1HSR7
Position
2
AA seq 279 aa AA seqDB search
MDFLLGRSVETMVAVAVAVVAVAVGGAFLLRRSKKPKGCLDPENFKEFKLVEKKQISHNV
AKFRFALPTPTSVLGLPIGQHISCRGQDATGEEVIKSYTPTTLDCDLGNFQLVIKMYPQG
RMSHHFREMKVGDYMSVKGPKGRFKYQVGQVRAFGMLAGGSGITPMFQVARAILENPNDK
TKVHLIYANVTSEDILLKEELDSMAEDYPDRFKIFYVLNQPPEVWNGGVGFVSQEMIKTH
CPAPAEDIQILRCGPPPMNKAMAAHLEALGYTNEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggatttcctgctggggcggagcgtcgagaccatggtggccgtcgccgtcgcggtcgtc
gccgtcgccgtgggcggcgccttcctcctccgacgatccaagaagcccaagggctgcttg
gatcctgagaacttcaaagagtttaaacttgtagaaaagaagcaaattagtcataatgtg
gccaaattccgatttgctctccccactcctacttctgtattaggccttccaattggtcaa
catatcagctgcagaggacaagatgccactggtgaagaagtaatcaaatcatacacacct
actacattggattgtgatcttggaaattttcagcttgttataaagatgtatcctcaagga
agaatgtctcatcattttcgtgaaatgaaagttggtgattatatgtctgtgaagggacct
aagggtcgtttcaagtaccaagttgggcaagttagagcattcggaatgctagctggtgga
tcaggcattactccgatgttccaagttgcaagggcaattctcgagaaccccaatgataaa
acaaaagttcatctaatctacgcaaatgtcacatctgaagacattcttctgaaggaagag
ctggacagcatggcagaagactatcctgatcgctttaagatcttctacgtcttgaatcag
cctcctgaagtatggaatggtggtgttgggtttgtatcccaggaaatgattaaaacccat
tgtccagcacctgctgaggatattcagatcctgagatgtggtcctcctcctatgaacaag
gcgatggccgcacaccttgaggcgcttggatacacaaatgagatgcagttccagttctaa

DBGET integrated database retrieval system