KEGG   Brachypodium distachyon: 100830829Help
Entry
100830829         CDS       T01717                                 

Definition
(RefSeq) nuclear pore complex protein NUP205 isoform X2
  KO
K14310  nuclear pore complex protein Nup205
Organism
bdi  Brachypodium distachyon
Pathway
bdi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100830829
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100830829
Chromosome and associated proteins [BR:bdi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100830829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 100830829
NCBI-ProteinID: XP_010233999
UniProt: A0A0Q3J739
Position
3
AA seq 1853 aa AA seqDB search
MPPPQPRELLAVIEAALLGPAPPSPGQRVELLHAVRDAAPAFRGLLSYPGPKASDRTQVE
AKEVRLPDMPPITLDDTDVQTALKLSDELNLNEIECVRLLVSANREWVLYGREPLEIYRL
AAGLWYMERRDLITSLYILLRSVVLDQGLDADLMYEIQNQMEALFSDGLQQRMITLVKEL
NREEPSGIGRPSSERYVLDFRGALVERRAIVSRERLSLSHCLALSALVKLMGPKEIKDAF
AILKDCAAEVNENTSVELQITYGVLFSLVITFVSDALSTSHEKASLPSSDSSFRHEFHEL
VTRTCNNTTVEGFVGVVRLAWTVLLMLTQDRSSARDSIINASSTLMTDIWSCMDIICRQN
AFEFLRERVIQTAAYQNDDDDIVYMYTGYAHKLMMCFLSHPTSKDKIKEIKEKAMNALSP
YVQARDHREDSSISGEQTGQPVNQPFVSLLELVGEIYQKEPELVHGNEELWTFVIYAGED
HTNTQTLVAFLGLLSTLASNEVGAAKVYELLQGKIYRSVGWNTLFDCLSIYEEKFKKSIQ
SSASMLPDFPEGDAQALVAYLAVLRKVVENGNPAERRKWFPDIEPLFKLLSYENVPPYLK
GALRNAITAFIKVSPLLKDAIWSYLEQYDLPVVTVPPGQHMATQVYDMRFELNEVEARRE
SYPSTISFLNLVNALIAEERNISDKGRRFMGIFKFVYEDVFGPFPQRAYADPREKWELAL
ACLEHFRMVLRMYDIKDDDIYAAFNTSGPSTSHASIERQLPVLELVKDFMCGKVAFRNIM
NIVLVGVDTLINERATQTYGILLEKTVHISLEIFILVMERDLVLADVYRPVYQPLDVVLS
QNHRQIVALLEFVRYDYLPQIQQCSIKIMGILSSRIVGLVQLLLKEDAAKSVIEDYAACL
EFRFDDFQVIENTKDDVGVLILQLLIDNISRPAPNMTHLLLKFDVNGPIERTVLKPKSHY
SCLKIILDNLEKVAKTDINALLHEFSFQLLYELCLDPLTCGPVMDLLSTTKYQFFSKHVG
TIAVSPLPKRNNNQALRISMLHERAWLLKMLALALHVSDISSSVYREACLAILSDTFGHC
AETMKSATIFQSPGTPVYTSNGPMHRNKVLDLLEVVQFRCPDTSMKYPQLLSNLNVESKI
EEILRNSATSEFGGVYYFSERGDRLIDLDAFHQKLLQMSQELNPQLSESEKGELKESFHH
ILKWAWKYNKNLEEQAAQLHMLTSWSQIVEVAVSRRMSLLDDRSQLLFELLDASLGATSS
PDCSVKMSYILTNVALTCMAKLRDERFICPTGADSDAVTCLDIISAKQLSNAACNSLLFK
LIMAILRSESSEHLRRRQYALLLSYFQYCGSVLDSDVPPSVIRFLLLEEQEGDDDELTLQ
KVLKEQSELARSNFAIIRKEAQAVIDLVTKDAIHGSEAGKAISFYVLDSLISIDHDKFFL
NQLQSRGILRSCLSDVSNYLSKDMSFSSEFSQRFCTVDSQFSLLLRISHHYGKHGSQILL
SMGALQNLSSCNLIGYQKKGNSKLSSNVVKERAGEVDKKRSLTAPVLRIVTSFTSLVDSD
DFLEVKNKVVREIVDFAKHHQFIFNSILRENISGANAFTLEQLNMAVSILSKVWAYEEDD
ECSYVQDLFSLMHSLFSLDFGSLNVIQSPNMIENQKSELVLFGLCFGLLSYLYFLATKKN
MRFEISYGDNSERGQQQPTLQMVSDLLNSVTLALERVGEEKYLLLNKVRDLNELSRKEVD
EIIKVCMKQDCISPNDNIRKRRYIAMIDLCCMAGNRDQLITLLLQVGECAITILLVHFHD
ESCAKDMSSFSDELLPILERLEHLKEDKVGRNLKLFHRSVTTLKELAVRSMSL
NT seq 5562 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccacagccgcgcgagcttctagccgtaatcgaggcggcgcttctcggcccc
gcgccgccatccccggggcagcgcgtggagctcctccacgccgtccgcgatgccgccccc
gcattccgcgggcttctctcttacccggggccgaaggcgtccgatcgaactcaggtggag
gccaaggaggttcggctcccggacatgccaccaatcactcttgatgacaccgacgtgcag
actgcccttaagttgagtgacgaactcaaccttaatgagattgagtgtgttcgtttgctc
gtttctgccaacagagagtgggttctatatggtcgagagccactggaaatatataggctt
gcggctggtctttggtacatggagaggagagatcttataacttctctgtacattttgtta
cggtcggttgtactcgaccaagggcttgatgctgatctgatgtacgaaattcaaaatcaa
atggaggctctatttagtgatggtctccagcagcggatgattacccttgtaaaggagctt
aaccgagaagaaccatctggcattggccgaccaagctctgagcgttatgtgcttgatttc
agaggagctcttgttgaaaggcgtgccattgtctcgagagagagactaagcttgagccac
tgccttgctctttctgcactcgtcaaactaatgggtcccaaggagattaaggatgcattt
gcaatattgaaagactgtgcagctgaagtaaatgaaaatactagtgtggagcttcagatc
acatatggcgttctgttctctcttgtaataacttttgtttctgatgcgctaagtacttcc
catgagaaggcatctttgccatcgtctgattcctcattcagacatgaatttcatgagcta
gtgacgaggacatgtaacaataccaccgttgaaggatttgttggtgttgtgcggcttgca
tggactgttcttttgatgctaacacaagatcgaagtagcgcaagagactcaatcattaat
gcttcctccacattgatgacagatatttggtcatgtatggacattatctgtcgtcagaat
gcttttgagtttttacgggagcgagttatacaaacagctgcctaccagaatgacgatgat
gacattgtttacatgtatactggatatgcacacaagttgatgatgtgttttctctcccat
ccaacttctaaagacaagataaaggaaatcaaggaaaaagcaatgaatgctctcagtcca
tatgtgcaagcacgagatcatagagaagattctagcataagtggggaacagactggtcag
cctgttaaccagccttttgtatctttactggaactagttggagagatctatcagaaagag
cctgagctagtgcatggaaacgaggaactgtggacttttgtcatatatgcaggtgaagat
cacaccaatacgcaaactcttgtggccttccttggacttcttagtactctggcttccaat
gaagttggtgctgccaaagtctatgaattgctccagggaaaaatttaccgctcagttggg
tggaacactttgtttgattgcttatcaatttatgaagagaagttcaagaaatccattcaa
tcttccgcaagcatgttgcctgattttccagaaggggacgcacaggcgcttgttgcgtat
ttggctgtccttcggaaggtggttgaaaatggaaatccggctgaaagaaggaaatggttc
cctgacattgagcctttgtttaagcttctcagctatgaaaatgtgcccccatatttgaag
ggggctttgcgaaatgcaatcactgcattcatcaaagtttcacccctattgaaagatgca
atttggagttatcttgaacaatatgaccttccggtggttacagttccacctggccagcac
atggcaacacaggtctatgacatgaggtttgagttgaatgaagttgaagcaaggagggaa
agttatccgtcaaccatatcatttcttaacttggtcaatgctctcattgcagaagaacga
aacataagtgacaaagggcggaggttcatgggtatctttaagtttgtatatgaggatgtc
tttgggccttttccccagagagcctacgctgatccgcgggaaaagtgggaattggcactt
gcctgcctggagcacttccgcatggttttgcgcatgtacgacataaaggatgatgatatt
tatgctgcttttaacacatctggaccttcaacatcacatgcttcaatcgagagacagctc
ccggtgctagaactggtcaaagatttcatgtgtgggaaggttgctttccgtaatattatg
aacatcgtattagtgggtgttgacactcttattaatgagcgagcaacccaaacttatggg
attcttctggagaaaactgtccacatttctcttgaaatatttattcttgtaatggagaga
gacttggttcttgctgatgtctaccgtccagtctaccagcccttggacgttgtattatct
caaaatcatagacagattgttgctttgctggagtttgtacgatatgactaccttcctcaa
attcaacaatgttcaataaaaattatgggcatcctgagttctagaatagttgggcttgtc
cagttgctcttgaaggaagatgcagctaaatctgtaattgaggattacgctgcttgcttg
gagttccggtttgatgatttccaggtcatagagaacacgaaagatgacgttggtgttcta
atattgcagctacttattgacaacatttctcgcccagccccaaatatgactcatctactc
ttaaaatttgatgtcaatgggcccatagaacgaacagttctgaaaccaaaatcccactac
agttgtttaaagataatacttgacaaccttgaaaaggtggcgaagacagatataaacgcc
ttacttcatgagttcagttttcagcttctgtatgagttgtgtcttgatcctttaacttgc
ggacctgtaatggatctcctgagtacaacaaagtaccagttcttttctaagcatgttgga
actattgctgtttcaccactccccaaaaggaacaacaatcaagctcttcgcatcagcatg
ctacatgagagggcttggttgcttaagatgctagcattggcactacatgtatccgacata
tcatcatctgtgtatcgggaagcttgtctggctattcttagtgatacttttggtcactgt
gctgagaccatgaagagtgcaaccatatttcaatctcctggcactccggtttacactagc
aatggaccaatgcatagaaataaggttttggacttgcttgaagttgtacagttcagatgt
ccagacacttcgatgaaataccctcagttgctttcaaatctgaatgttgaatcgaagatt
gaggagatcctaaggaattccgcaacgtctgaatttggtggtgtatattatttttcggag
agaggtgatcgactgattgatctggatgccttccatcaaaaacttctccagatgtcacaa
gagttgaacccgcagttgagtgagtctgaaaaaggcgagttaaaagaatcattccatcat
attctgaaatgggcctggaaatataacaaaaatctcgaagaacaggcagcccagcttcac
atgttgactagctggtctcaaattgttgaagtagctgtttctaggaggatgtcattactt
gatgatcgttctcagttattgtttgagctgcttgatgcttcattgggtgccacgtcatct
ccagactgttcagtgaaaatgtcgtatattttgaccaatgtagcattgacctgtatggct
aaattgcgggatgaaagattcatatgcccaactggtgcagattctgatgcagttacttgc
cttgacattatttcggcaaaacagttatcaaatgcagcctgtaactcgttattgtttaag
ctcattatggcaatattgagaagtgaatcgtctgaacatttgagaagacgccaatatgca
ttactattgagttatttccagtattgtggtagtgttcttgactctgatgttcctccatca
gttattcgcttcttgctacttgaagaacaggagggagatgatgatgaactcactcttcaa
aaggttctgaaggaacagagtgaattagcgcgttccaactttgccatcataaggaaggaa
gctcaagcggtcatcgatttggttaccaaggatgctattcatgggagcgaagctgggaaa
gcaatttcattctatgttcttgattcattgataagtattgaccatgacaagtttttctta
aaccagcttcaaagtcgtggaattcttagatcatgtctaagtgatgttagcaactatttg
tcaaaggacatgtcattctcatcagagttttcacagcggttctgcactgttgattctcag
ttttcattacttctgagaatcagtcaccattatggtaaacacggctctcagattttgttg
tccatgggtgctttacaaaacctttcatcgtgcaacctcataggttatcagaaaaaggga
aattcaaaactaagctccaacgttgtgaaggaacgagctggggaagttgataagaagagg
tcacttactgcaccagtactgcggatagtcacatctttcacatcacttgtggactcggat
gattttttagaggtgaagaacaaagttgtacgtgagatagtggattttgcaaagcatcat
cagttcatttttaatagcattttgagagagaatatatctggagcaaatgccttcaccttg
gagcagcttaatatggcggtttctattctcagcaaggtatgggcatatgaggaagacgat
gaatgcagctatgtccaagatctattttccctgatgcattctctttttagtcttgatttt
gggtctctgaatgtcattcagtcaccaaacatgattgagaatcagaagtcagaactggta
ttgttcggtctctgctttggcctgctctcttacctatattttctggctacaaagaagaac
atgcgcttcgagatttcatatggtgataacagcgaacgcggtcaacagcaaccaacactg
caaatggtttcagatcttttgaactctgtaacacttgctctggagagagtaggcgaagaa
aaatacttgttgttaaataaggttcgtgacttgaatgagttatctaggaaggaggtcgac
gagataataaaagtatgcatgaagcaagattgcatctcgcccaacgataacatccgtaaa
aggaggtacattgcaatgatagatttgtgttgcatggctggcaaccgagaccagcttatt
acccttctactccaagtcggcgaatgtgccatcactattctcctcgttcattttcacgac
gagtcttgtgcaaaagacatgtcttcattttctgatgaactactccctatactggagagg
ctggagcatttaaaagaggacaaagttgggcgtaatctcaagttgttccacagatctgtg
accactctgaaagagttggcagtcagaagcatgtccttatga

DBGET integrated database retrieval system