KEGG   Brachypodium distachyon: 100831816Help
Entry
100831816         CDS       T01717                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00562  Inositol phosphate metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100831816
   00562 Inositol phosphate metabolism
    100831816
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100831816
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100831816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100831816
NCBI-ProteinID: XP_003563716
UniProt: I1GLM0
Position
1
AA seq 515 aa AA seqDB search
MAPSTSLPFLLLLGALLAVALLSSAAEPEAFDVRRHLSTVTRYDVARGSNSMVSAPSISD
QCRVIHLNLVARHGTRAPTKKRIKELDRLAVRLGALVNEAKQGPDSDSLKKIPSWIEGWE
SRWKGRVKGGELVSEGEEELFNFANRVKERFQGLFDEEYHPDVYSIRATQVPRASASAVA
FGLGLLSGKGKLGEGKNRAFSVLSESRASDICLRFFDSCQTYKDYRKRKEPDVEKQKEPI
LEIVTSALVNRYHLNFTKQDVSSLWFLCKQEASLLNITNQACQLFNEAEVYFMEWTDDLE
GFVLKGYGESINYKMGLPLLKDVVQSMEEAIIAKEENHPDGTYEKARLRFAHAETVVPFT
CLLGLFLEGSDFEKIQREEPLDLPPVPPQTRNWKGSVVAPFASNNMLVLYQCPGKINGGK
VSQDQNSSYFVQVLHNEAPVSMPGCGNKDFCPFDEFKEKIVQPHVKHDFDVLCKIKKPVV
TEEPSSFSSKLSNFFLASFSRKGYHVKAQDMKTEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctccgagcacgtctcttcccttcctcctcctcctcggcgcgctcctcgcggtcgct
ctcctctcgtcggcggccgagcctgaggcgttcgacgtccgccgccacctctccaccgtc
accaggtacgatgtggccagagggtccaacagtatggtctccgcgccgtctatctcggat
cagtgccgcgtgatccacctcaatctcgttgcaagacatgggactcgtgctcctaccaaa
aagaggatcaaggagttggataggctggcggttcgtctgggagctcttgtgaatgaggca
aaacaaggacctgacagtgattctctgaagaaaatcccgtcctggatagagggatgggag
tcacgttggaagggtagggtgaaaggcggtgagctggttagtgaaggcgaggaagagttg
ttcaattttgctaacagagtgaaggagagatttcaaggcctttttgatgaagaatatcac
ccggacgtatactcaataagagcaactcaggttcctcgagcatcagctagtgcagtagca
tttggtttgggattactttctgggaaaggaaaacttggagaagggaaaaaccgcgccttc
tctgttctgagtgagagtcgtgcaagtgatatttgtctgcgattcttcgatagctgtcaa
acatacaaggactacagaaaaagaaaggagcctgatgttgagaagcaaaaggaaccaatt
ctagaaatcgtcacgtctgctctagtcaaccgttatcacctcaattttacaaaacaagat
gtttcttcgctctggttcctttgcaaacaggaagcatccttactgaatataaccaatcaa
gcttgtcaacttttcaatgaagctgaggtttattttatggagtggacagatgatttggag
ggttttgtccttaaaggttatggtgagtcaataaactataaaatgggactaccattgctc
aaggatgttgtccagtcaatggaagaagcaatcatagctaaagaagaaaaccaccctgat
ggtacatatgagaaggcaaggctccgatttgcacatgcagaaactgttgttcctttcaca
tgcctccttggtcttttcctggaaggatcagattttgagaagatacagcgggaggaacca
ttggatctacctcctgtgccaccacagacaagaaattggaagggcagtgttgtagcacct
tttgctagcaacaatatgttggttttataccaatgccctggcaaaattaatggcggcaaa
gtatctcaggatcaaaacagctcttactttgtacaggttctacacaatgaagccccagtt
tctatgccaggctgtggcaacaaggatttctgtccatttgacgagttcaaggaaaagata
gtccagccgcatgtgaagcatgacttcgatgtgctatgcaagataaagaaacccgtggta
acagaggagccatcctctttcagctccaagctgtcgaacttttttctggcttccttctcc
cggaaagggtaccatgttaaggcacaggacatgaagactgagttgtaa

DBGET integrated database retrieval system