KEGG   Brachypodium distachyon: 100831910Help
Entry
100831910         CDS       T01717                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01230  Biosynthesis of amino acids
Module
bdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100831910
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     100831910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 100831910
NCBI-ProteinID: XP_003579935
UniProt: A0A0Q3P2Y5
Position
5
AA seq 409 aa AA seqDB search
MEALAIGSVPSRPGLPPPTRHSHLRRPKTLLASAPPCRIIAAVPMDGAASRSPAPLRCTP
AETDAVATSSDETAATAEATQQGDGIPVEDAAASIEGVDGIKIRRRPVTGPSVHYVGPFQ
FRLENEGNTPRNILEKIVWNKDVEVWQMKERRPLYMLKGPLDNAPPARDFVAALKASYDR
TALPALIAEVKKASPSRGVLRENFDPVVIAQTYEINGAACLSVLTDAKYFQGSFDNLEAI
RNAGVQCPLLCKEFIIDAWQLYYARSKGADAVLLIAAVLPDRDIKYMLKICKILGMAALV
EVHDEREMDRVLGIDGIQLIGINNRNLETFEVDISNTKNLLEGERGQLIAQKGIIVVGES
GLFTPDHISFVQNAGVKAVLVGESLIKQEDPGKAIAGLFGKDISHASAV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgctcgctatcggatccgtgccttcccggccaggcctaccacctccgacccgc
cactcccatcttcggcgccccaaaaccctactcgcctccgcgcccccttgccgcatcatc
gccgccgttcccatggacggcgccgccagccggagccccgcgcctctccgctgcactccc
gccgagacggatgctgtggcgacgagctcggacgagacggcggccacggctgaagccacc
cagcagggcgacggaatcccagtggaagatgccgccgcaagcatcgagggggtcgacggg
ataaagattcggaggcgcccggtgacggggccgtcggtgcactacgttggcccgtttcag
ttccgcctcgagaacgaggggaacacgcctcgcaacatcctcgagaagattgtgtggaat
aaggacgttgaggtttggcagatgaaggagagaaggcccttgtacatgctgaaaggtccg
ctggacaatgcgcctccagcgagggactttgtagcggccctgaaagcatcatatgatcgg
actgctctgcctgctctgattgcagaggtcaagaaggcttcaccaagccggggggttctg
agggagaattttgatccggtcgtgatcgctcaaacatacgagataaatggagcagcatgc
ttaagtgttcttacagatgcaaaatacttccagggaagttttgacaacttggaggctata
cgcaatgctggagtacagtgtcctcttctgtgtaaagagttcatcattgatgcctggcaa
ctttactatgcacgttccaagggagcagatgctgttcttctgattgctgctgtcttacca
gatcgtgatatcaagtatatgctgaaaatatgtaaaatacttggcatggctgctttagtt
gaggtgcatgatgaaagggaaatggaccgtgttctagggatagatggtattcagctcatc
ggcatcaataaccgtaatcttgagacttttgaagttgatatctcgaataccaaaaatctt
ctggagggtgaacgaggacaacttatagcccagaagggaataattgttgtaggggaatct
ggactgttcacacctgaccatatttcatttgttcagaatgctggggtcaaagcagttctc
gttggggagtccctcatcaagcaggaggatccagggaaagcaatagctgggctttttggt
aaagatatctcacatgcgagtgctgtgtaa

DBGET integrated database retrieval system