KEGG   Brachypodium distachyon: 100832738Help
Entry
100832738         CDS       T01717                                 

Definition
(RefSeq) flavonoid 3'-monooxygenase CYP75B4
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00941  Flavonoid biosynthesis
bdi00944  Flavone and flavonol biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100832738
   00944 Flavone and flavonol biosynthesis
    100832738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bdi00199]
    100832738
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     100832738
Cytochrome P450 [BR:bdi00199]
 Cytochrome P450, plant type
  CYP75 family
   100832738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Hemerythrin
Motif
Other DBs
NCBI-GeneID: 100832738
NCBI-ProteinID: XP_003562884
Position
1
AA seq 542 aa AA seqDB search
MLAFCMSKRSNSWRATAEACMELIGALDVPLRLPWLVSALAISVTVCYILFFSRAGKGNG
KGLPPGPRGWPVLGNLPQLGGKTHQTLHELTKVYGPVLRLRLGSSVAVVAGTAGTAEQFL
RAHDAQFRDRPPNSGGEHMAYNVFGPYGPRWRAMRKVCAVNLFSARALDGLRGFREREAA
LMVKSLAAAAASAAEPVALGKAANVCTTNALSRAAVGRRVFDEMGGSAGGELKEIVLEVI
DVGGVLNVGDFVPALRWLDPQGVVARMKKLHRRFDDMMNGIIGERLQGTDAAGEKDLLGL
LLDAMMKEDKSLSGGEELTHTDIKALILNLFVAGTDTTSSIVEWAMSELIRHPDLLQQAQ
EELDAVVGRARLVSESDMSRLPFLTAVIKETFRPHPSTPLSLPRMASEECFVAGYRIPKG
TELVVNVWGIARDPALWPDPLEFRPARFLIGGSNSVVDLKGSNFELIPFGAGRRICAGLS
WGLRIVMIAVATLVHAFDWKLPVGQTPDELNMEEALSLLLLRAVPLMVHPAPRLLPSAYE
IA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgttctgcatgagcaaacgctcgaacagttggcgtgcaacagctgaggcatgc
atggagctcatcggagcacttgacgtccccctccgcctcccgtggctcgtctccgcattg
gccatttccgtgaccgtatgctacatcctcttcttctcccgcgccggcaagggcaatggc
aaggggctacctccggggccgaggggctggccggtgctggggaacctcccgcagctcggc
ggcaagacgcaccagaccttgcacgagctgaccaaggtgtacggccccgtgctccggctg
cggctgggcagctccgtggccgtggtcgccgggacggcaggcaccgcggagcagttcctc
cgcgcccacgacgcccagttccgcgaccggcccccgaattccggcggcgagcacatggcg
tacaatgtcttcgggccctacggtccgcggtggcgcgccatgcgcaaggtctgcgccgtc
aacctcttctccgcccgcgcgctcgacggcctccgcgggttccgcgagcgggaggcggcg
ctcatggtgaaatcgctggccgccgccgctgcctctgctgcggagccggtggcgctgggc
aaggcggcgaacgtgtgcacgaccaacgcgctgtcgcgggcggcggtggggcggagggtg
ttcgacgaaatgggcgggagcgccgggggcgagttgaaggagatcgtgctggaagtgatc
gacgtgggcggggtcctgaacgtgggggacttcgtgccggcgctccggtggctcgacccg
cagggggtggtggccaggatgaagaagctgcaccgccgcttcgacgacatgatgaacggg
atcatcggcgagaggctgcagggcacggatgcagctggggaaaaggacttgctgggattg
ctgctcgatgccatgatgaaggaggacaagtcgctcagcggcggcgaggagctcacgcac
acggacatcaaggccctcattctgaacctatttgtggcgggcactgacacgacctcaagc
attgtggagtgggccatgtcggagctgatccggcatccagacctccttcagcaggcgcag
gaggagctagacgccgtcgttggccgggccaggcttgtctccgagagcgacatgtcgcgc
ctccccttcctcaccgccgtcatcaaggagaccttccgcccgcacccatctacgccattg
tccctcccgcggatggcctccgaggagtgcttcgtagccggctaccgcatccccaaaggc
acggagctggtggtcaatgtgtggggcatcgcgcgcgacccggctctctggcccgaccca
ctcgagttccggccagcccggttcctcattggcggatccaactccgttgtggacctcaag
ggatccaatttcgagctgattccgtttggggccggtcggaggatatgtgcggggctcagc
tggggtttaaggattgtgatgattgcggtggcgacgctagtgcatgcgttcgattggaag
ctgccggtggggcagacgccggatgagctcaatatggaggaggcgttatctctgttgctg
ctgcgggccgtgccgttgatggtccacccagcgcctaggctcctcccatcggcatatgaa
attgcatag

DBGET integrated database retrieval system