KEGG   Brachypodium distachyon: 100832805Help
Entry
100832805         CDS       T01717                                 

Definition
(RefSeq) probable tRNA (guanine(26)-N(2))-dimethyltransferase 1
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bdi03016]
    100832805
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     100832805
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     100832805
Transfer RNA biogenesis [BR:bdi03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    100832805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRM Methyltransf_25 Cons_hypoth95 PrmA Methyltransf_31 ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 100832805
NCBI-ProteinID: XP_003558242
UniProt: I1H701
Position
1
AA seq 601 aa AA seqDB search
MGEVENKLEDYEVKKEGEAEILMLKSNAVFFNPVQVHNRDMSIAVLRTFVSKRKEEHEAQ
MNKRNKSQKKGNHSETSVVNEEAVLTSQHDEMDVVLEKEPNQATDEIEGPSKEATKTPSW
KVTRELKAPIVLEALAASGLRSLRYAREVDGLGKVVALDNDKASVEACKRNIKFNGASAV
SKVEAHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAVQAVADGGLLMCTATDLAVLC
GTNGEVCYSKYGSYPVKGKYCHEMALRILLASIESHANRYKRYIVPVLSVFMDFYVRVFV
RVFTSASEIKNTPLKLSYVYQCAGCDSFHLQCLGRTVTKNNSVKYAPGIGPVVPQECSDC
GKKFNVGGPIWSAPIHDQDWVLSTLTDVRSMKDRYPAYNKITSVLTTVSEELHDIPLFFS
LHNISGTVKCTSPSSVMFRSAVINAGYQISSSHVNPLGLKSDAPWDVIWDIMRCWVKNHP
IKEQPRDSPGTAILSKSPKLEASFSRAVAALSKAQAKKVKRFLPNPESHWGPKVRAGRKI
TSKHISLLGAEAINGAISHEDGNGVLTEKPASHIGETVTDEEREPSTKRQKTGDGELAGE
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagtggagaataagctcgaggactatgaggtcaagaaggaaggcgaggctgag
atcctcatgctcaagagcaacgccgtgtttttcaatcccgttcaggtgcacaacagagac
atgtcaattgctgttttaaggacctttgtttccaagcgcaaggaagagcatgaggcacag
atgaacaaaaggaataagtcacagaaaaaaggaaatcatagtgaaacatccgttgtaaat
gaagaagctgttttaactagccagcatgatgaaatggatgttgttcttgaaaaggagcca
aatcaggccacggatgaaatagagggtccgtcaaaagaagcaacaaagacaccttcctgg
aaagtaaccagagagcttaaggcaccaattgttcttgaggctttggctgcttctgggttg
aggtctctccgttatgctcgtgaagtagatggattaggaaaggtagttgctctcgacaat
gataaagcttctgttgaagcttgcaagaggaacataaagtttaacggggcttctgctgtt
agtaaggtggaagctcacttggctgatgctcgagtttacatgctcacccatccaaaagaa
tttgatgtggttgatcttgacccctatgggtcaccatctgtgttcctcgactcagctgta
caagccgttgctgatggtgggttattgatgtgcacagccactgatttggcagttctgtgt
ggaaccaatggagaagtttgctactccaagtatggctcctatccagtcaaaggcaagtat
tgccacgaaatggctttgagaatcctccttgccagtattgagagccatgcaaatcggtac
aagagatatattgtgcctgttctctctgtgtttatggatttctatgtccgtgtttttgtt
cgagtattcacgtctgcaagtgaaataaagaatactcccctcaaactttcttatgtatat
caatgtgctggttgtgattctttccatcttcagtgccttgggagaacggttactaagaat
aacagcgtaaagtatgcgcctggtattggtcctgttgttcctcaagagtgcagcgactgt
ggaaagaaatttaatgtgggtggaccaatatggtcagctcctattcatgatcaagattgg
gtactttctacactgacagatgttaggtcaatgaaggacagatatcctgcatacaacaaa
attacttcagttctaactactgtgtcggaggaattgcatgacattccattgttttttagt
ctccataacatatctggtactgttaagtgcacatctccgtcttcagttatgttccggtct
gcagttataaatgctggatatcagatttcaagcagccacgttaatccgcttgggctcaaa
tcggatgccccttgggatgttatttgggacatcatgcgctgctgggtgaaaaatcatcct
atcaaggaacaaccacgtgactctccaggcacggcaatactttcaaaatcgccaaaacta
gaagcaagtttctctcgagcagttgctgccctcagcaaggctcaggcaaagaaggtcaag
cggtttcttccaaacccagaaagtcattggggtccgaaggtcagggcaggtaggaagatt
actagtaagcacatctctctgctaggggcagaagctatcaacggagctatcagccacgaa
gatggaaatggagtcttgacagaaaaacctgcttcacatattggagagactgttacagat
gaagagagggaaccttcaaccaaacgccaaaaaactggagatggcgaactggccggtgaa
ccttga

DBGET integrated database retrieval system