KEGG   Brachypodium distachyon: 100834926Help
Entry
100834926         CDS       T01717                                 

Definition
(RefSeq) acetyl-CoA carboxylase 1
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00061  Fatty acid biosynthesis
bdi00620  Pyruvate metabolism
bdi00640  Propanoate metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01212  Fatty acid metabolism
Module
bdi_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100834926
   00640 Propanoate metabolism
    100834926
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100834926
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100834926
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     100834926
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100834926
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100834926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Biotin_lipoyl Dala_Dala_lig_C GAS
Motif
Other DBs
NCBI-GeneID: 100834926
NCBI-ProteinID: XP_010234694
UniProt: A0A0Q3JE04
Position
3
AA seq 2263 aa AA seqDB search
MVESGQINSMSNSRHPSLPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRTWALE
TFGTEKAILLVAMATPEDLKINAEHIRIADQFLEVPGGTNNNNYANVQLIVEIAERTRVS
AVWPGWGHASENPELPDALKEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLPWSGS
HVKVPPETCHSIPEDIYKNACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVHNDEE
VRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQKIIE
EGPITVAPPETVKELEQAARRLAKCVQYEGAATVEYLYSMETGEYYFLELNPRLQVEHPV
TEWIAEINLPASQVAVGMGIPLYNIPEIRRFYRMEHGGGYHAWKEISSAATKFDLDKAES
ARPRGHCVAVRVTSEDPDDGFKPTSGRVEELNFKSKPNVWAYFSVKSGGAIHEFSDSQFG
HVFAFGESRSLAIANMVLGLKEIQIRGEIRTNVDYTVDLLNASEYRENKIHTGWLDSRIA
MRVRAERPPWYLSVVGGALYEASSRSSTVVTDYVGYLSKGQIPPKHISLVNLTVTLNIEG
SKYTIETVRGGPRSYKLRINESEIEAEIHSLRDGGLLMQLDGNSHVIYAETEAAGTRLLI
NGRTCLLQKEHDPSKLLADTPCKLLRFLVVDGSHVVSDTPYAEVEVMKMCMPLLLPASGV
IHFVMPEGQAMQASDLIARLDLDDPSSVRRAEPFQGTFPKLGPPTAVSGKVHQKFAASVN
SAHMILAGYEHNINQVVQDLLNCLDSPELPFLQWQEIMSVLATRLPKDLRNELDGKYKEY
ELNADFRKSKDFPAKLLRGVIEANLAYCSEKDRVTNERLVEPLMSLVKSYEGGRESHARV
VVKSLFEEYLSVEELFSDDIQSDVIERLRLQHAKDLEKVVYIVFSHQGVRNKNKLILRLM
EALVYPNPSAYRDQLIRFSALNHTAYSGLALKASQLLEHTKLSELRTSIARSLSELEMFT
EEGERVSTPRRKMAINERMEDLVCAPLAVEDALVALFDHSDPTLQRRVVETYIRRLYQHY
LVRGSIRMQWHRSGLIALWEFSEEHIAQRNGQSATVLNQQVDHPIYKRWGVMVVIKSLQF
LSTAIEAALKETSHYGAGVGNISNCNPVTPNSSNMLHIALVGINNQMSTLQDSGDEDQAQ
ERINKLSKILKDNTITSHLNGAGVRVVSCIIQRDEGRPPMRHSFQWSVDRLYYEEDPMLR
HVEPPLSTFLELDKVNLEGYNDVKYTPSRDRQWHIYTLVKNKKDQRSNDQRMFLRTIVRQ
PSVTNGFLPGSIDNEVSRAQASSSFTSNSILRSLMAALEEIELHAHNEAVRSGHSHMYLC
IMREQQLFDLIPFSRMSGEVGQDEATTCTLLKHIVLNIYEHVGVRMHRLSVCQWEVKLWL
ACDGQANGAWRVVVTNVTGHTCTVDIYREVEDPNIHQLFYRSATPTAGPLDGVALHEPYK
PLDAIDLKRYAARKNETTYCYDFPLAFETALKKSWKSSISHVGEANEHNRRYVKVTELMF
ADSTGSWGTPLVPVERSPGINDIGIVAWSMKLSTPEFPGGREIIVVANDVTFKAGSFGPR
EDAFFDAVTNLACERKIPLIYLSATAGARIGVAEEIKSCFHVGWFDDQSPERGFHYIYLT
EEDYSRLSSSVIAHELKLETGETRWVVDTIVGKEDGLGCENLHGSGAIASAYSKAYRETF
TLTFVTGRAVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIM
ATNGVVHLTVSDDLEGVFAILKWLSYVPPYVGGPLPILKPLDPPDRPVTYFPENSCDARA
AICGIQDSQGKWLGGMFDRGSFVETLEGWAKTVITGRAKLGGIPVGVIAVETQTMMQVIP
ADPGQLDSAERVVPQAGQVWFPDSATKTAQALLDFNHEELPLFILANWRGFSGGQRDLFE
GILQAGSTIVENLRTYKQPAFVYIPKAGELRGGAWVVVDSKINPEHIEMYAESTAKGNVL
EAEGLIEIKFRPKELEESMLRLDPELTNLNVRLREMKKENASLSEMETIGVSMTVRMKQL
MPIYTQVATRFAELHDTSSRMAAKGVISKVVDWKESRTFFYKRLRRRVAEDSLAKEVREA
AGEQLSHRSALECIKKWYLASKGSEGDSEQWNDNEGFFAWKDDRRNYENYLEELEAERVS
KWFSHLAESSDVKALPNGLSLLLGKMNPTKREQVIDGLRELLG
NT seq 6792 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatccggccaaataaacagcatgtctaattcgaggcacccatctttaccgtcc
gaggttgatgaattctgtaaagcacttgggggcgactcaccaatacacagtgtgctagtt
gccaacaatggaatggctgcagtcaagttcatgcgtagcatccgcacctgggccttggag
acgtttggaacagagaaggcgattcttttggttgctatggcaactccagaggatctgaag
ataaatgcggagcacataagaatcgccgaccagttcttagaagtacctggcggaacaaat
aataacaactacgctaatgtacagctcatagttgagatagcagagagaactcgtgtttct
gcagtttggcctggctggggtcatgcttcggagaacccagaacttccagatgcgctgaaa
gagaaaggaataatttttcttgggccaccatcagccgcgatggctgctttaggtgataag
attggttcttctcttattgctcaagcagcaggagttccaactcttccatggagtggatca
catgtgaaagtcccgccagaaacctgccactcgatacctgaggatatttataaaaacgct
tgtgtttccactactgaggaagcagtggctagttgtcaggtggtggggtatcctgccatg
atcaaggcatcatggggaggtggcggtaaaggaataaggaaggtacacaacgatgaggag
gtgagagcattgtttaagcaagtgcaaggagaagtccctggatcgcctatatttattatg
aaggtggcatctcagagccgacatttggaggttcagttgctctgtgacaagcatggcaat
gtagcagcactacacagtcgagactgtagtgttcaaagaaggcatcaaaagattattgaa
gaggggccaattacagttgctcctccagaaacagttaaagagcttgagcaggcagcaagg
agactagctaaatgtgtgcaatatgagggtgctgctacagtagaatatctatacagcatg
gaaacaggggaatactatttcctggagcttaatccacgattgcaggtcgaacaccctgtg
accgaatggattgctgaaataaacttgcctgcatctcaagttgcagtaggaatgggcata
cccctgtacaacattccagagatcagacgcttttacagaatggaacatggaggtggctat
catgcttggaaggaaatatcaagtgctgcaaccaaatttgacttggataaagcagagtct
gcaaggccaaggggtcattgtgttgcagttagagttactagtgaagacccagatgatggg
tttaagcctactagtggaagagtggaagagctaaactttaaaagtaaaccaaatgtttgg
gcctacttctctgttaagtctggaggagcaattcatgaattttctgattctcagtttggt
catgttttcgcttttggggaatctaggtcattggcaattgccaatatggtacttggatta
aaagaaatccaaattcgtggagagatacgcacaaatgttgattacacagtggatctattg
aatgcttcagagtaccgagaaaataagatccataccggttggctagatagcagaatagct
atgcgagttagagcagagaggcccccatggtacctttcagttgtgggaggagctctatat
gaagcatcaagtaggagctcaactgttgttacggattatgtcggttatctcagcaaaggg
caaataccaccaaagcacatatctcttgtcaatttgactgtaacactgaatatagagggg
agcaaatatacgattgagacagtaagaggtggacctcgtagctacaagttaaggattaat
gaatcagagatcgaagccgagatacattcgttgcgagatggaggactcttaatgcagttg
gatggaaatagtcatgtaatttatgcggagacagaggcggctggtacgcgcctcctaatc
aatggcagaacatgcttattacagaaagaacacgacccttccaagttgttggctgataca
ccatgcaaacttcttcggtttttggtcgtggatggctctcatgtggtgtctgatacacca
tatgctgaggtagaggtcatgaagatgtgcatgccactgttactacctgcatctggtgtc
attcactttgtcatgcctgagggtcaggccatgcaggcaagtgacctgatagcaaggttg
gaccttgatgacccatcttctgtgaggagagccgaaccatttcagggcacctttccaaaa
cttggacctcctactgctgtttctggcaaagttcaccaaaaatttgctgcaagtgtgaat
tctgcgcacatgatacttgcaggatatgaacataacatcaaccaagttgtacaggatttg
ctaaactgcctagacagccctgagctcccttttctacagtggcaagaaattatgtctgtt
ttagcaacccggcttccaaaagatctcaggaatgagttggatggtaagtacaaggagtat
gagttgaatgctgatttccggaagagcaaggattttcctgcgaagttgctaaggggggtt
attgaggcaaatcttgcatactgttctgagaaagacagggttactaatgagaggcttgtg
gagccacttatgagcctggtcaagtcttacgagggtggaagggaaagccatgctcgtgtt
gttgtgaagtctctgtttgaggagtacttgtctgttgaagaactcttcagtgatgacatt
cagtctgatgtgatagaacgtctacgacttcaacatgcaaaagatctcgagaaggtcgta
tatatagtgttctctcaccagggtgtgagaaacaaaaataaattaattctacggcttatg
gaagcactggtctatccaaatccatctgcttacagggaccagttgattcgcttctccgcc
ctgaaccatacagcatactctgggctggcacttaaagcaagtcaacttcttgagcacacg
aaattgagtgaactccgcacaagtatagcaagaagcctttcagagctggagatgtttact
gaggaaggagagcgggtgtcaacacctagaagaaagatggccatcaatgaaaggatggaa
gatttagtttgtgctccacttgcagttgaagacgcccttgtggctttgtttgatcacagt
gatcctactcttcaacggagagtcgttgagacatacatacgcagattgtatcagcattat
cttgtaaggggcagtatccggatgcaatggcacaggtctggtctaattgctttatgggaa
ttctctgaagagcatattgcacaaagaaatgggcagtcagcgacagttctaaatcaacaa
gtagaccatcccatttataagcgatggggtgtaatggttgtaatcaagtctcttcagttc
ttatcaactgcaattgaagctgcattgaaggagacttcacattacggagcaggtgttgga
aacatctcaaattgcaatcctgtaactccaaatagtagcaatatgcttcatattgctttg
gttggtatcaacaatcagatgagtactcttcaagacagtggtgatgaggatcaagcacaa
gaaaggatcaataaactttccaagattttgaaagataacactataacatcacatctcaat
ggtgctggtgttagggtcgtcagctgcattatccaaagagatgaagggcgtccaccaatg
cgccactccttccaatggtcagttgacaggctatattatgaggaagacccgatgctccgc
catgtggaacctcctttgtccacattccttgagttggacaaagtgaatttagaaggctac
aatgacgtgaaatacaccccatcgcgtgatcgccagtggcatatttacaccctagtaaag
aacaaaaaagatcagagatcaaatgatcaaaggatgtttcttcgtaccatagtcaggcag
ccaagtgtgaccaatgggtttttgcctggaagtattgataatgaagtaagccgtgcccaa
gcctcttcatcattcacatcaaatagcatactcagatcattgatggcagcactagaagaa
atagagttacatgctcataatgaggctgtgaggtcaggccattcacacatgtatctgtgc
attatgagagaacaacagttgtttgatctaattccattttcgaggatgtcgggtgaagtt
ggtcaagatgaagcgacaacatgcacacttttgaagcatatagttttgaatatatatgag
catgttggtgtcaggatgcatcgcctttctgtgtgtcagtgggaagtgaagctatggtta
gcctgtgatgggcaagctaatggtgcttggagagttgtcgttacaaatgtaactggccac
acctgcactgttgatatttaccgagaagtggaggacccaaatatacatcaacttttctac
cgctctgccacacccacagctggtcctttggatggtgttgcattgcatgagccatacaag
cctttggatgctattgacctgaaacgttatgctgctaggaaaaatgaaactacatactgc
tatgatttcccattggcatttgaaacagcattgaagaagtcatggaaatctagtatctct
catgtgggagaagctaacgagcataatcggcggtatgttaaagtgacagagcttatgttt
gctgattctactggatcatggggtactcctttggttccagttgagcgttctcctggtatc
aatgatattggcattgttgcttggagcatgaagctctccacaccagaatttccaggaggc
cgggagataatagttgtcgcaaatgatgtgacatttaaagctgggtcctttggtcctaga
gaagatgcgttcttcgacgctgttactaatcttgcttgtgagaggaaaattcctcttatc
tacttgtcagcaactgctggcgctagaatcggtgtagcagaggaaataaagtcatgcttc
catgttggatggtttgatgatcagagccctgagcgtggttttcattacatttacctcact
gaagaagactattcaaggctaagctcttcagttatagcccatgagttgaaactggaaact
ggagagaccagatgggttgttgatactattgttgggaaagaagacggactcggttgtgag
aatttacacggaagtggtgccattgccagtgcctattctaaggcatatagggagactttt
actctgacatttgtgactgggcgagctgttggaattggggcctatcttgctcggttaggc
atgaggtgtatacaacgtcttgatcaaccaattattttaactgggttttctgcgctgaac
aaacttctgggccgtgaggtttatagctctcatatgcaactgggtggccccaaaatcatg
gctacaaatggagtcgtccatctgactgtgtcagatgatcttgaaggtgtttttgctatc
ttgaaatggctaagctatgttcctccctatgtcggcggtcctcttcctattctgaaacct
cttgacccaccagatagacctgtaacatattttcctgagaattcatgtgatgcccgtgca
gccatctgtggcattcaggacagtcaaggcaagtggttgggtggtatgtttgatagagga
agctttgtggaaacgttagaaggttgggcaaaaactgttattaccggaagagcaaagctt
ggtggaattccagttggtgtcatagctgtggaaacccagacaatgatgcaagtaatccct
gctgaccctggtcaacttgattctgctgagcgtgtggtgcctcaagcaggacaggtgtgg
ttcccagattctgccacaaaaacagcccaggcattgctggattttaaccatgaagaactc
ccgttgttcatccttgctaactggagaggcttttctggtgggcaaagggatctgtttgaa
ggaatacttcaggctggttctacgattgttgagaatctgaggacatataagcagcctgct
tttgtgtatatcccaaaggctggagagctacgtggaggtgcatgggttgtggtggatagc
aagatcaatcctgagcacattgagatgtatgctgagagcactgcaaaagggaatgtcctt
gaggcagaagggctgattgagatcaaatttaggccaaaggaacttgaggagagcatgtta
aggcttgaccccgagttgacgaaccttaatgttagactcagagaaatgaagaaagaaaat
gctagcctctctgaaatggaaaccatcggggtgagtatgacagttcggatgaagcagctg
atgcctatatatactcaggttgctacacggtttgctgaattgcatgacacgtcttccagg
atggctgccaaaggtgtgatcagtaaggttgttgattggaaggagtctcgaaccttcttc
tataagagattgcgaaggagggttgctgaggattcacttgccaaagaagttagagaagct
gctggtgagcagctatcccacagatcagcattggagtgtatcaagaaatggtatctagct
tccaagggttctgaaggggatagtgaacagtggaatgataatgaaggtttctttgcttgg
aaagacgatcgcaggaactatgagaattatcttgaggagttggaagctgaaagagtttcc
aaatggttctcgcatcttgctgaaagctcagacgtgaaagccttaccaaacggtctttca
ctccttcttggcaagatgaatcctacaaaaagggagcaggttatcgatggcctcagggag
cttctcggttga

DBGET integrated database retrieval system