KEGG   Brachypodium distachyon: 100835224Help
Entry
100835224         CDS       T01717                                 

Definition
(RefSeq) phosphoinositide phospholipase C 2
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00562  Inositol phosphate metabolism
bdi01100  Metabolic pathways
bdi04070  Phosphatidylinositol signaling system
bdi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100835224
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100835224
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100835224
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100835224
Membrane trafficking [BR:bdi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100835224
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100835224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 DUF4719
Motif
Other DBs
NCBI-GeneID: 100835224
NCBI-ProteinID: XP_003569051
UniProt: I1HMM3
Position
2
AA seq 602 aa AA seqDB search
MTTYRVCCFLRRFRPASSEPSAAIAAVFRSYASAASAGDVLGEEALKRFLREVQGEEGGS
AGVGDEDEDGGVEALVREIMAFAAQQKLLKKGGGGGGIAAEGFHRWLCSDANAAIHPRRG
VHQDMGQPLSHYYIYTGHNSYLTGNQLSSGSSVAPIVKSLLDGVRVIELDLWPNAGKDDV
EVLHGRTWTSPVGLGECLDAVKEHAFVSSPYPVILTLEDHLTPHLQAKVAKMIKETFGDM
LHISQSETMAEFPSPDDLKGKIIISTKQPKEYLQTKSSKEDSQNGDKEEEESVWGEEIPD
NKAQPAVARQMSEPDNGQGVEEEDEMDKKVQPGVDGEYKRLIAIQLTRRKHDMNEDLKVD
PEKVTRMSLGEKAYEKATITHGADIIRFTQRNLLRIFPRTTRITSSNYNPLMGWRYGAQM
VAANMQGHGRKLWLTQGMFRANGGCGYVKKPDFLMNSDPDKMFDPRSKLPVKTRLKVTLY
MGDGWRFDFHKTHFDKFSPPDFYARVGIAGVAADTRMEESKVVMDNWIPTWDHEFVFSLA
VPELALLRIEVHEADNHQKDDFAGQTCLPVWELRQGIRSVRLCARDGELLRSVKLLMRFE
FA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatacagggtgtgctgcttcctgcggcggttccggccggcgtccagcgagccg
tcggcggccatcgccgccgtcttccggtcctacgcctccgccgccagcgccggtgacgtg
ctcggggaggaggcgctcaagaggttcctccgggaggtgcagggggaggagggcggcagc
gccggcgttggggacgaagacgaagacggcggcgtcgaggcgttggtgagggagatcatg
gcgttcgcggcgcagcagaagctgctgaagaagggcggcggcggcggggggatcgccgcc
gaggggttccaccgctggctctgcagcgacgccaacgccgccatccatcctcgccgcggg
gttcaccaggacatggggcagccgctgtcgcactactacatctacacgggccacaactcg
tacctgacggggaaccagctgagcagcggctccagcgtggcgcccatcgtcaagtccctc
ctggacggcgtcagggtcatcgagctcgacctctggcccaacgccggcaaggacgacgtc
gaggtcctgcacggcaggacatggacgtcgcccgtcgggctcggcgagtgcctggacgcc
gtgaaggagcacgccttcgtctcctctccttaccccgtcatcctcaccctcgaagatcat
ctcaccccccatctccaggccaaagttgcaaagatgatcaaggaaacattcggggacatg
ctccacatctcgcaatccgagaccatggcagagttcccttcccctgatgatctcaagggg
aagatcatcatatcgaccaagcagcccaaggagtacctccagaccaagagcagcaaggag
gattcacagaacggcgacaaggaagaggaggagagcgtttggggagaggagatccccgac
aacaaggcccaacctgccgttgctcgccagatgtcagagccggacaatgggcagggcgtg
gaagaagaggatgagatggacaagaaggtgcagccaggggttgatggcgagtacaagcgc
ctcatcgcgatccaactaacccgaaggaagcacgacatgaatgaggatctcaaggttgac
cccgagaaggtgacgcggatgagcttgggggagaaggcgtacgagaaggccaccatcacc
catggagctgacattatcaggtttacacagaggaatttgctgcggattttcccacggacg
acacgcattacttcctctaattacaatcctctgatgggctggaggtatggagctcagatg
gttgcagcaaacatgcagggccatggaaggaaactatggctgactcaagggatgttcagg
gcaaatggcggttgcggctacgtgaaaaagcccgattttctgatgaacagcgacccggat
aaaatgtttgaccccagatccaagctaccagtgaagacaaggctcaaggtgactctctac
atgggtgacggatggcgattcgacttccacaagacgcatttcgacaagttctcgccaccg
gacttctatgcaagggtgggtatagcaggagtggcagcagacacaaggatggaggagagc
aaggtagtcatggacaactggatcccgacgtgggaccacgagttcgtgttctcgctggcc
gtgccggagctggcgctgctccgcattgaggtacacgaggccgacaaccatcagaaggac
gacttcgccggccagacctgcctaccggtgtgggagctccggcaagggatacgctccgtc
aggctctgcgcgcgcgacggcgagctgctgaggtctgtcaagctcctcatgcgcttcgag
ttcgcctga

DBGET integrated database retrieval system