KEGG   Brachypodium distachyon: 100835837Help
Entry
100835837         CDS       T01717                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g54610 isoform X1
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bdi01001]
    100835837
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100835837
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100835837
Protein kinases [BR:bdi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100835837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 100835837
NCBI-ProteinID: XP_003567686
UniProt: I1HFA9
Position
2
AA seq 548 aa AA seqDB search
MGCVFGRASSSATRKKEKASPKPAPSNGSPADGDKSLGRPRRRLGRRTGPRQGCVPAPAA
AEQLAAGWPPWLVAVAGEALRGWTPRRADTFEKLNKIGSGTYSNVYRARDTVSGRIVALK
KVRFDNLEPESVKFMAREILILRRLDHQNVIKLEGLVTSRMSCSLYLVFEYMEHDLAGLA
ASPEVKFTLPQIKCYMHQLLSGLEHCHDNNVLHRDIKGSNLLLDNNGVLKIADFGLAALF
DPRHKRPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLYGKPIMPGRTEVEQ
LHKIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCIRDTFKDFPPSSLQLVETLLAIDP
AERQTSTAALQSEFFASEPYACDPSSLPTYPPSKEMDAKLRDEEARRLRAAAKAKGEVAK
RTRTRDRSHRAGPAPEANAELQTNLDQRRRMITHANAKSKSEKFPPPHQDGAMGNPLGSC
RHMEPTYEHQDTSFSTVVPIEKGTSQTWSGPLFDPSALGQSRRKKQTALDAKAAAYSKQL
RKEKGRAH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgtcttcggccgcgcgtcctcgtccgcgacgaggaagaaggagaaggcgtcc
ccaaagcccgcgccctccaacggttccccggcggatggagacaagtccctcggaaggccg
aggcggaggcttgggcgacggacggggcccaggcaggggtgcgtccccgctcccgccgcc
gccgagcagctcgctgcggggtggcctccatggctcgtcgccgtcgccggggaggccctc
cgagggtggacgccccgccgggcagacaccttcgagaagctcaacaagataggatcgggc
acctacagcaacgtgtatcgggcgagggacactgtctcaggccgcatcgtggcactgaag
aaggtccggttcgacaacctggagcctgagagcgtcaagttcatggcaagggagatcctg
atcctgaggaggctcgaccaccaaaatgtgatcaaattggagggattagtgacctccagg
atgtcatgcagcctatacctggtgttcgagtacatggagcatgaccttgctggccttgca
gcaagccctgaagtcaagtttactctgccacagataaaatgttacatgcaccagcttctg
tcaggacttgagcattgccatgacaataatgtgctgcatcgggatatcaagggttcgaac
ttgctgttggataataatggggttcttaagattgctgattttgggctggcagcactcttt
gacccacgccacaagcggccgatgacgagccgtgtggtcacactgtggtaccgaccacca
gaattattattaggtgcgacagattatggtgtgggtgtggatttatggagtgctgggtgc
attctggcagagcttttatatggaaagcccatcatgcccgggcgcaccgaggtagagcag
ttgcacaagattttcaagctatgtggctccccatcggaggagtattggaagaagtcaaaa
ctgccacatgctacaatatttaaacctcagcaaccttataaacgttgcatcagagataca
tttaaagattttcctccatcttccctgcaattggttgaaactctgcttgcaatagatcca
gctgagcgtcaaacttctacagctgcattgcaaagtgaattctttgcatctgagccttat
gcatgtgatccatcaagcttgccaacgtatccaccaagcaaggagatggatgccaagttg
agagacgaagaggctagaaggctacgagctgctgcaaaggccaaaggagaggtggctaaa
aggactcgaacgcgggatcgatctcatagggctgggccagcaccagaggctaatgcagag
cttcaaacaaatctagatcagaggcgacgcatgataacccatgcaaatgccaagagtaaa
agtgagaagttccctccaccgcatcaagatggagctatgggtaatcccttgggatcctgt
cggcatatggagcctacatatgagcaccaggatacttccttcagtactgtagtgcccatc
gagaagggaacctcacaaacatggtcggggccgttgtttgatccgtcagcgcttgggcaa
tcacggcggaagaagcagactgccctagacgcaaaggctgcggcttattcaaaacagctt
cgaaaagagaagggacgagcgcattag

DBGET integrated database retrieval system