KEGG   Brachypodium distachyon: 100835902Help
Entry
100835902         CDS       T01717                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase RIPK
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bdi01001]
    100835902
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100835902
Protein kinases [BR:bdi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100835902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 100835902
NCBI-ProteinID: XP_010227886
Position
1
AA seq 444 aa AA seqDB search
MGFRRGLLGCLGCGGDDYYEDPEEQSPAAAAAAAGGPGRRRRAVMNLRSLSLEDLSRTLA
TTSLHAFTLDELKAATRNFSASNFLGEGGFGPVYKGSLDAALRPGLAPQQVAVKYLDLDS
DGVQGHREWLAEVVYLGMLSHPHLVKLVGFCNQDDQRMLVYEYMPRGSLENHLFKNLLAS
LPWSTRLKIAVGAAKGLAFLHEAQTPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPKGD
ATHVTTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKRRRGREQNLV
DWARPYLRRADDRMLDRIMDPSMESQFSARAARSAAAVAHACLQSVPKARPRMRDVVEAL
EPLLALDDDVPMGPFVFTVGAGAAATEAAAVVAANVPAGDVEEPAAPQGKWHVKSAVHAE
NPLRKGDRWVKNAVKRPESPPGVI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggggttcaggcggggcctgctggggtgcctggggtgcggcggcgacgactactacgag
gatccggaggagcagagcccggcggcggcggccgccgcggcaggggggcccgggcggcgg
cggcgcgcggtgatgaacctccggtcgctgtcgctggaggacctgtcgcggacgctggcg
acgacgagcctgcacgccttcaccctggacgagctcaaggccgcgacgcgcaacttctcc
gcctccaacttcctcggcgagggcggcttcggccccgtctacaagggctccctcgacgcc
gccctccgccccggcctcgccccgcagcaggtcgccgtcaagtacctcgacctcgacagc
gacggcgtccagggccatcgcgagtggctggcggaggtggtgtacctggggatgctgagc
catccgcacctggtgaagctggtgggcttctgcaaccaggacgaccaacggatgctcgtg
tacgagtacatgcccaggggcagcctcgagaaccacctcttcaagaacctgcttgcgtcc
ttgccatggtcgacgcggctcaagatcgccgtcggcgccgccaaggggctggcgttcctg
cacgaagcccagacgccggtgatctaccgcgacttcaaggcctccaacattctgctcgac
tcggactacacggcgaagctgtcagacttcggcctggccaaggaaggtcccaagggcgac
gccacgcacgtgacgacccgtgtcatgggcacgcacggctacgcggcgccggagtacatc
ctgacgggccacctgacggccaagagcgacgtgtacagcttcggcgtggtgctcctggag
ctgctcacgggccggcgctccgtcgacaagcgccggcgagggcgcgagcagaacctcgtg
gactgggcgcgcccgtacctgcggcgcgccgacgacaggatgctggaccgcatcatggac
ccgagcatggagtcccagttctcggcgcgcgccgcccggagcgcggccgccgtggcgcac
gcgtgcctgcagagcgtgcccaaggcgcgcccgcggatgcgcgacgtcgtggaggcactc
gagccgctgctggccctcgacgatgacgtgcccatgggccccttcgtgttcacggtcggc
gccggcgctgctgcgaccgaggcggcggcggtggtggcggctaacgtgcccgccggggac
gtcgaggagccggcagcgccgcagggcaagtggcatgtcaagtcggccgtgcacgcggag
aacccgctgcgcaagggcgaccgctgggtgaagaacgccgtgaagcggcccgagagcccc
ccaggcgtgatctga

DBGET integrated database retrieval system