KEGG   Brachypodium distachyon: 100836478Help
Entry
100836478         CDS       T01717                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00030  Pentose phosphate pathway
bdi00051  Fructose and mannose metabolism
bdi00052  Galactose metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
bdi01230  Biosynthesis of amino acids
bdi03018  RNA degradation
Module
bdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100836478
   00030 Pentose phosphate pathway
    100836478
   00051 Fructose and mannose metabolism
    100836478
   00052 Galactose metabolism
    100836478
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100836478
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100836478
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100836478
Messenger RNA biogenesis [BR:bdi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100836478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100836478
NCBI-ProteinID: XP_003574548
UniProt: I1I7F8
Position
3
AA seq 530 aa AA seqDB search
MAVALKTIGSFCNTQQQCLHSTRDRILYGYSHSNTKECKSKNAKRPAPLCVKATSTKVEL
DFSDPSWKQKFQEDWDERFNLPRITDIYDDLKPRPTTFSLKKKRTPRSDEDSTPMDMWNG
YVNNDDRALLKVIKYSSPTSAGAECIDPDCSWVEQWVHRAGPRKEIYYEPEEVKAAIVTC
GGLCPGLNDVIRQVVFTLETYGVKNIVGIPFGYRGFFEKGLKEMPLSRDLVENINLAGGS
FLGVSRGGAKTSEIVDSIQARRIDMLFVLGGNGTHAGANAIHDECRKRKLKVSVVAVPKT
IDNDIPLMDKTFGFDTAVEEAQRAINSAYIEARSAYHGIGLVKLMGRSSGFIAMHASLSS
GQVDICLIPEVPFTLDGEYGVLQHLEHLLENKGFCVVCVAEAAGQELLQKSGATDASGNV
ILSDIGVHMQQKIKMHFKGIGVHADVKYIDPTYMVRACRANASDAILCTVLGQNAVHAAF
AGFSGITSCICNTHYVYLPITEVITSPKRVNPNSRMWHRCLTSTGQPDFH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgctttaaagacaatcggtagtttttgtaacacacagcagcagtgtctacat
tcaacaagagatcggattttgtacggttattcccattcaaataccaaagaatgcaaaagc
aagaatgcaaaaaggcctgctccactgtgtgttaaagctacttccacgaaagtggaactg
gatttcagcgatccatcttggaagcagaagtttcaggaagactgggatgagcgttttaat
ttgccacgtattacagatatatatgatgatttgaaaccaaggccaactacattctcactc
aagaaaaagaggacccctagaagtgatgaagatagtacaccgatggatatgtggaatggc
tacgtgaacaatgatgaccgagcacttctgaaggtgataaagtattcctcacctacttct
gctggagcagagtgcattgatcctgattgtagctgggtcgagcaatgggtgcatcgtgca
gggcctcgtaaggaaatatactatgagccagaggaagtaaaagctgctatagttacttgt
ggaggtctctgccctggattgaatgatgtcatcagacaggtagtattcacccttgagacc
tatggggttaagaatattgttgggattccatttggttatcgtggatttttcgaaaaaggc
ctaaaagaaatgcctctttcacgtgatctagtggagaatattaatcttgctggtggaagt
tttctaggagtctctcgtggaggagctaaaactagtgagattgtggatagtatacaggcc
agaagaattgatatgctttttgtacttggtggaaatggtacccatgcaggagcaaatgct
atccatgatgagtgccgtaagagaaagctcaaagtttcagttgtagcagttccaaagacc
attgacaatgatatacctttgatggataagacatttggttttgatactgcggtggaagaa
gctcaacgggccattaactccgcctatatagaggcacgtagcgcataccatggtatcggt
ttggtcaaattaatgggaagaagcagcggcttcattgcaatgcatgcttccctttcaagt
gggcaggttgatatctgcttaataccagaggtcccgttcacgctagatggagaatatggt
gttttacagcaccttgagcatttattagaaaacaagggcttctgtgtggtttgtgttgct
gaagctgcaggacaagaattattgcaaaaatcaggtgcaactgatgcatcaggaaatgta
atacttagtgacattggtgttcacatgcaacaaaagattaagatgcatttcaagggtatt
ggtgttcatgctgatgtgaaatacattgatccaacatacatggtccgggcatgtcgcgcc
aatgcatctgatgcaattttgtgcactgtacttggacaaaatgctgtccatgcagccttt
gctgggttcagtggcatcacttcctgcatttgcaacactcactacgtctacctccccatt
acagaagtcatcacatcacctaagcgtgtgaaccctaatagcaggatgtggcaccgttgt
ctcacgtccactggccagccggacttccactga

DBGET integrated database retrieval system