KEGG   Brachypodium distachyon: 100836549Help
Entry
100836549         CDS       T01717                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bdi  Brachypodium distachyon
Pathway
bdi03040  Spliceosome
bdi04141  Protein processing in endoplasmic reticulum
bdi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100836549
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100836549
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100836549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bdi01009]
    100836549
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bdi03041]
    100836549
   03009 Ribosome biogenesis [BR:bdi03009]
    100836549
   03110 Chaperones and folding catalysts [BR:bdi03110]
    100836549
   04131 Membrane trafficking [BR:bdi04131]
    100836549
   03051 Proteasome [BR:bdi03051]
    100836549
   03029 Mitochondrial biogenesis [BR:bdi03029]
    100836549
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdi04147]
    100836549
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100836549
Spliceosome [BR:bdi03041]
 Complex B
  Other components
   Prp19 complex
    100836549
 Complex C
   Prp19-CDC5 complex
    100836549
Ribosome biogenesis [BR:bdi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100836549
Chaperones and folding catalysts [BR:bdi03110]
 Heat shock proteins
  HSP70 / DNAK
   100836549
Membrane trafficking [BR:bdi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100836549
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100836549
Proteasome [BR:bdi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100836549
Mitochondrial biogenesis [BR:bdi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100836549
Exosome [BR:bdi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100836549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 100836549
NCBI-ProteinID: XP_003567007
UniProt: I1HQI4
Position
2
AA seq 625 aa AA seqDB search
MTGTGDQQEGGTIAIGIDLGTSWSCVGVYRHRHGRVEIIINEQGSRTTPSCVAFSDTESL
LVGEAALNQAARNPTNTVSGAKRLPGRRFSDASVRSDMNLWPFKVVAGRGDKPMIAASHR
RRQKLLAGEEIAAMLLVKIKRDAESYLGGTVTNAVVTVPVSFDVLQRRATKDAFAVAGLD
VLGVVHEPVAAAVAYYGLFHESGTETKNVVVFDLGGGHTSAALLTISAGKIAVEATAGDA
HLGGEDFDGRMVEHFVEQLKTEYGKEDVGRSARALVRLRAACEQAKRTLSSSTWAPIEID
CLLEGVDFRTTITRDQFEDLNTDLFCRCMEPVKKCLSDAKLDRSNVHDVVLVGGSTRIPC
LRRMLRDLFDGKELLRKDINPEEAVARGAAILAAAVVSRVPDSDLLDLILSDTTPRSLGV
EAAGGAMAVIIPKNSTIPIRREQIIALHSQEPTSVVIPVFEGENPIARENSLLGELKLSA
VHRGTQRGGSERQVSVCFDIDADGVMTVNARDRATKNANQMKFMDKGQLSKQEIERMAEE
AAEYMAQDAENRDRVNAKNLLEECLYVKRRKIEAERKKANDALSGLEQMIQQVDNDQVSS
AKKFREDLEVLMVEGSTVAGKLGDA
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgacggggacgggtgatcagcaggagggcggcacgattgcgataggcatcgacctcggg
acttcgtggtcttgcgtcggcgtgtaccggcaccggcacggccgcgtggagatcataatc
aacgaacaaggcagccggacaacgccgtcctgcgtcgcgttctcggatacggagagcctc
ctcgtcggcgaggcggccctgaaccaggccgcccggaaccccactaacaccgtctccggt
gctaagcgactgccgggaaggagattcagcgacgcgtccgtgcggtccgacatgaatcta
tggccattcaaggtcgtcgccggccgcggcgacaagccaatgatcgccgcgagccacaga
cgcaggcagaagctgctcgccggggaggagatcgcagccatgctgctcgtaaagataaag
agggacgctgagtcctacctcggaggcaccgtcacgaacgccgtggtcacggtccccgtg
tccttcgacgtcctccagcggcgcgccaccaaggacgccttcgccgtcgcgggcctcgac
gtcctcggcgtcgtccacgagcccgtggccgccgccgtcgcgtactacggcctcttccac
gaaagtggcacggagacgaagaacgtggtcgtctttgaccttgggggcggtcacaccagc
gcggcactcctgacgatctccgccggcaagatcgccgtcgaggcaacagccggcgacgcc
cacctcggcggcgaggatttcgacgggcgcatggtcgagcatttcgtcgaacagctgaag
acagagtacgggaaagaagacgtcggccgcagcgcgagggctctggtgaggctgagggcg
gcgtgcgagcaggcgaagaggacgctctcgtcaagtacctgggcccccatcgaaatcgac
tgcctgctcgagggcgtcgacttccgcacgaccatcacccgggatcagttcgaggacctc
aacacggacctcttctgcaggtgcatggagcctgtgaagaagtgcctcagcgacgccaag
ctcgacaggagcaacgtgcacgacgtcgtcctcgtcggcgggtcaacccgaatcccttgc
ctgcggcgtatgcttcgggatctttttgatgggaaagagctcctccgcaaagacatcaac
cccgaggaagccgtggcgcgcggcgctgccattctcgccgctgccgtagtcagccgcgtg
cccgacagtgacttgctggacctgatcctgtccgacaccacgccgcgctcgctcggcgtg
gaggcggccggcggtgccatggccgtgatcatccccaagaatagcaccattcccatcaga
agggagcagattattgccctccattctcaagagccgacgagtgtcgttatcccggtgttt
gaaggcgagaaccccatcgcaagggagaacagcttgctcggcgagctcaagctttctgcc
gtccatcgtggaacacaacgcgggggcagcgaacgccaggtttcggtgtgctttgacatc
gatgcagacggagtcatgacggtgaacgcgagggacagggcgaccaagaatgcgaaccag
atgaagttcatggacaaaggccagctgagcaagcaggagatcgagaggatggccgaggag
gcagcggagtacatggcacaggacgcggagaacagggacagggtcaacgcgaagaacctg
ctcgaagaatgcttgtacgtgaagcgccgtaagattgaggccgaaaggaagaaggcgaac
gatgctctttccggcttggagcagatgattcagcaggtggacaacgaccaggtttccagc
gccaagaagttccgagaggatttggaggtgctcatggtggaggggagcaccgtcgctggt
aagctgggtgatgcgtga

DBGET integrated database retrieval system