KEGG   Brachypodium distachyon: 100836912Help
Entry
100836912         CDS       T01717                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bdi04131]
    100836912
Membrane trafficking [BR:bdi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100836912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 100836912
NCBI-ProteinID: XP_010240535
UniProt: A0A0Q3P7M1
Position
5
AA seq 1838 aa AA seqDB search
MSAADLLVADAAAREWQRFKLIPRVSCAGNLDLDPLLNENLEQWPHLNELVQCYKADFVK
DDCKYGRYESVAPPSFRSQIFEGPDTDIETELQLSKPEETTEDDMPSTSGRQIYETEPSA
SSSNKPCSLSPLPAYEPAFDWNNERSLIFGQRVTESLPATHISGLKITVKVLSLSLEAGL
VEPFGGTICLYNRDRREKLSEDFYFRILPTEMQDAHISLDRWGVFSLDAPSPSVCLLIQL
EKAATEEGGVTPSVYSRKEPVHLTEKEKQKLQIWSRIMPYKEPFAWAMIPLFENNHAGGV
GDAASPSSPLARSISGSSSQDSIMEPTSKLALDGKLNHYSSGSSVIVEISNLNKVKESYI
EDSLQDPKRKAHKPVKGVLRLEVEKLHNDRNDADTISEGGSMNNELHGAELNNGRHHRNS
FDGAHSYLNSSAVAQKNAHQNGQNSNAENGDNFQAFDFRMMTRSEPFSQLFHCLYVYPLT
VSLSRKRNLFVRVELRKDDADIRKLPLEAIHPTDWSTTLQKFVHTQISVGTRMSCFHDEV
KISLPALLTPQHHLLFTFFHVDLQMKLEAPKPVIVGYAALPLSTHIQLLSEVSLPILREL
VPHYLQESGKERMEYLEDGKAVFRLRLRLCSSLLPVNERIRDFFVEYDRHTLHTSPPWGS
ELLEAINSLKNVESTALLQFLHPILNMLLRLIGDGGETLQVAAFRAMVNILTRVQQESSD
GAERNRFLVNYVDFAFDDFGDRQTPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWF
FLELIVKSMGLEQSRLFYHNLPLGEDVPPLQLKEGVFRCIMQLFDCLLTEVHERCKKGLN
LAKRLNSTLAFFCYDLLSIIEPRQVFELVSLYMDKFAGVCQSVLHDCKLTFLQIICDHDL
FVEMPGRDPSDRNYLSSVLIQEIFLTLDHDDLLQRAKAARILVVLISKHEFDARYQKSED
KLYIAQLYFPLIGQILDEMPVFYNLNAVEKREVLVVILQIIRNLDDTTLIKAWQQSIART
RLFFKLLEECITHFEHNRTGDSLLLGSSSRSPDAERPVSPKYSDRLSPSVNAYLSEASRH
EIRPQGTPENGYMWNRVSPQLSSPNQPYSLREALAQAQSSRIGSTARALRESLHPVLRQK
LELWEENLSTAVSLEVLGIIEKFSVAAASLSISTDYTKLDCVTSILMGLLSRSQPLTFWE
AFLPVVYNIFSLHGATLMARENDRFLKQIAFHLLRLAVFRNDSVRKRAVVGLQILVRNSF
NYFKSTTRLRVMLTITLSELLSDVQVTQMKSDGSLEESGEARRLRKSLEEMADVRSKDQL
NDCGLPVNALEVAAEGSTDNRWSWVEVKHLSKCLVQALDAGLEHALLGSVTTLDRCAAAE
GFYKLALAYAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVGRNDAVWS
REHVASLCRICPIVGTDVGAEVSAAEVEGYGASKLTVDSAVKYLELANKLFAQAELYHFC
ASIQELIIPVYKSRRAYGQLAKCHASLTNIYESILEQEASPIPFIDATYYRVGFYGDRFG
KLNKKEYVFREPRDVRLGDIMEKLSHTYEAKMDGNQNLHIIPDSRQVNADELQPGVCYLQ
ITAVDPVMEDEDLESRRERILSLSTGTVRARVFDRFLFDTPFTKNGKTQGGLESQWKRRT
VLQTEGSFPALVNRLLVIESESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRL
QSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRV
HFRLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcggatctgctggtggcggacgcagcagcgagggaatggcagcggttcaag
ttgattccaagggtgtcgtgtgctgggaacctggacctggatccactgcttaatgaaaat
ttagagcaatggccacatctaaatgagttggtacagtgctataaggctgattttgttaaa
gatgactgcaaatacggtcgatatgagagtgtcgcaccaccgtcctttcgaagtcaaatt
tttgagggacctgatactgacatagaaacagaattgcagctttccaagcctgaggaaact
actgaagatgatatgccaagcacctcagggaggcaaatatatgagactgaaccgtctgct
tcatcttcaaacaaaccctgtagtctctcacctttaccggcatacgaacctgcatttgat
tggaacaacgagagatctttgatatttggccaacgggtgacagaaagtctccctgcaaca
cacatcagtggattgaagataactgtaaaggtgttatctttgtcattagaagctggatta
gtagaaccttttggcggtacaatttgcttgtacaacagagatagaagagaaaaactatct
gaagacttctatttccgcatacttccaacagaaatgcaagatgctcatatttctttggac
cgttggggtgttttttcgttggatgccccttcaccatcagtctgccttctgatccagctt
gaaaaagctgctactgaagaagggggagtaactccttccgtttattcccgcaaagaaccc
gtgcacttgactgagaaagagaagcagaagctgcaaatttggtctcgaatcatgccatat
aaagagccatttgcatgggcaatgattcctttgtttgaaaacaaccatgctggtggtgtg
ggtgatgcagcctctcctagcagccctttagcacgaagtatttcaggctcaagttctcaa
gatagcatcatggagcctacttccaagctcgctttggacggaaaactcaaccattattca
agtggaagctcggttattgtagagatatcaaacttaaacaaagtgaaggaaagctacata
gaggactccctccaagatccgaaacggaaagcacacaaaccagttaaaggtgtactgagg
ctagaggtggaaaaacttcataatgaccgtaatgatgcagataccatttctgaaggtggg
agcatgaacaatgaattgcatggtgctgaactcaataatggcagacatcacaggaatagc
tttgatggggcccacagttatctgaattctagtgctgttgcccagaaaaatgcacaccag
aatggtcaaaattccaatgcagagaatggtgacaattttcaagcttttgactttcggatg
atgactcgaagcgaaccattttctcaacttttccattgcctgtatgtgtacccattgacc
gtcagcttgagccgcaagagaaatctattcgtaagagtagaattgagaaaggatgatgct
gacatccgtaaacttccactggaggctattcatccaacggattggagtacaacgctacag
aagtttgtccatacccagatttctgttggcacgagaatgtcttgcttccatgatgaagtg
aagatcagtctgcctgctctattgactccccaacatcatcttctgttcacattcttccat
gtagatctccaaatgaaacttgaagcccctaaaccagtgattgtgggatatgctgcactt
ccactgtcgacgcacattcagttactttcagaggtatctttgccaattttacgagagctt
gttccgcattacctgcaggaaagtggaaaggagagaatggaatacctggaggatggaaaa
gctgttttcaggctgcggttaagactttgctcttcgttgttgccagttaatgaaaggata
agagacttttttgtcgagtatgaccgccacacactacatacaagtccaccttggggttct
gagcttcttgaggccataaatagtttaaagaatgttgaatctactgcattgttacaattt
cttcacccaatactcaacatgctgctgcgtcttattggtgatggtggtgaaacacttcag
gttgctgcatttcgagccatggttaatattctaacccgggttcagcaggaatcatctgat
ggggctgagagaaataggtttcttgttaattatgttgattttgcttttgatgactttggt
gatcggcagacacctgtataccctggtttatctactgtttggggtagcctagctcggagt
aaggctaaaggttatagagttgggcctgtctatgatgatgtgttggcaatggcttggttt
tttctggagcttattgtaaaatcaatgggattggaacaaagtcgtctcttctaccacaat
cttccactaggtgaagatgtcccgccgctacagttgaaagaaggtgtattcagatgtatc
atgcagctgtttgattgccttttaactgaggttcatgaacgctgtaaaaagggtttaaat
ttggcaaagcgcttgaacagcactcttgctttcttttgttatgatcttttatcaatcatc
gagccacgccaagtttttgagctggtttcgttgtatatggacaagtttgcaggggtttgt
caatcagttctccatgattgcaaattgacattcctgcagataatatgtgatcacgatctt
tttgttgagatgcctggccgagacccctctgataggaattatctctcgtctgttcttatc
caggagatctttctcacccttgaccatgatgatttattacagcgagcaaaagcggctcgt
attttggttgtcctgataagcaagcatgaatttgacgcacggtatcaaaaaagtgaagac
aagctgtacattgctcagctgtatttccctcttataggacagattctagatgagatgcct
gtgttctataatctaaatgctgttgaaaagcgtgaagttctagtggtcattttgcaaatc
ataaggaacttggatgacacaactcttataaaagcgtggcaacagagcattgctagaacc
agactgttcttcaagctacttgaagaatgtataacccattttgagcacaatagaacagga
gatagcttgctgctaggctctagttctcggagtcctgatgctgagcgccctgtgtccccc
aagtattctgatcgattatccccatcagttaacgcatacttgtccgaggcttcacgccat
gaaataaggcctcagggaacaccagaaaatggatacatgtggaacagggttagccctcaa
ctaagttccccaaatcaaccctattcattgagggaagcacttgctcaagcacaatcttca
agaattggatcaacagccagggcattgagagagtctctacatccagtactgagacagaag
ttggaactctgggaagaaaatcttagtaccgctgtgagccttgaagtattgggaataatt
gagaagttttcggttgcggcagcttctcttagcatctctactgattacactaagctagat
tgtgtgacatctatcttaatgggtcttttgtctaggagccagcccttaactttttgggaa
gcttttcttcctgtggtctataatatattcagtcttcatggtgcaacactgatggcacgg
gagaatgaccgcttcttgaagcaaattgcttttcatcttttgcgacttgctgtattccga
aatgattctgttaggaaaagggccgttgttggattgcagatccttgttaggaactcattc
aactatttcaagagcaccacaaggttgagggtcatgttgactattactttgtcagaattg
ctgtctgatgtgcaagtaactcaaatgaaatctgatggctctcttgaagaaagtggtgaa
gctcggcgtcttagaaaatcactagaggaaatggctgatgtcagaagtaaggatcagttg
aacgactgtgggctccctgttaacgcactggaggtggctgctgaaggttccactgacaac
aggtggtcttgggtagaagttaaacatctatcaaaatgtctagtccaggcccttgatgct
ggccttgaacatgcccttttgggttccgtaacaactctggacaggtgtgcagctgctgag
ggtttctataagctagcattggcctatgcacctgttcccgatcttcatattatgtggtta
ctgcacctatgtgacgcccaccaggagatgcaatcatgggctgaagctgcacagtgtgca
gttgctgtagctggtgtgatcatgcaggcacttgttggaaggaatgatgctgtgtggagc
agggagcatgttgcttccctgtgtaggatctgtcctattgtcggcactgatgtgggtgca
gaagtatctgcagcagaagttgagggatatggtgcatccaagcttactgtggattcagct
gtgaagtatcttgaacttgccaacaagctcttcgcacaggctgaactataccatttttgt
gctagcattcaggaactcattattcctgtgtacaagagcagaagggcttatgggcaactg
gctaagtgccatgcgtcactcacgaacatctatgagtcaattcttgaacaggaggctagc
cctattccattcattgatgccacatactacagagttggattttatggggatcgatttggc
aagctcaataaaaaggagtatgtgtttagagagccacgggatgttcgtctgggtgacatc
atggagaagcttagtcacacctatgaggctaagatggatggcaatcagaatttacacata
attcctgactcgagacaagtcaatgccgatgagctgcaacctggtgtctgctatctgcag
ataactgctgttgatcctgtaatggaggacgaggacttggagagtaggagggaaaggatt
ctctctttatctactggcactgtgcgtgcacgcgtgtttgaccgtttcctcttcgataca
ccattcacaaagaatgggaaaacacaaggtggcctcgaatctcaatggaagagacgcacg
gtactccaaacagagggctcgtttcctgctttggtaaatcgcctgctagtgatcgaatct
gaatctctagagttttcgcctgttgagaatgcaattgggatgattgaaacaaggacagct
gcattgagaaatgaattagaagaaccacgtagttctgaaggtgatcaactaccaagactt
caaagcctgcaaaggatactccaaggaagtgtagctgttcaggtcaacagtggtgtatta
agtgtttgcactgctttcttatctggagagcctgcaaccaggctccgatctcaagaactg
cagcagctcatcgctgcattgcttgaattcatggcggtttgcaagcgcgctatccgtgtg
cattttagattgataggggaagaagaccaggaattccacacgcaacttgtcaacgggttt
cagtcccttactgctgagctttcccactatattcctgctatactttcggagctatga

DBGET integrated database retrieval system