KEGG   Brachypodium distachyon: 100837729Help
Entry
100837729         CDS       T01717                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100837729
   00500 Starch and sucrose metabolism
    100837729
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100837729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 100837729
NCBI-ProteinID: XP_003559454
Position
1
AA seq 575 aa AA seqDB search
MGMAIIQARTWVVFLLLALLSPSWPVAEASHHVSPDLQSLDAGLAADALRTGYHFQPPMH
WINDPNGVMYYKGVYHLFYQYNPKAAVWGNIVWAHAVSTDLVNWVMLEPAIYPTAPFDVN
GCWSGSATVLPDGRPAIMYTGIDGDGRQVQNVAYPKDLSDPYLREWVKPDYNPVIPPGSG
VNATAFRDPTTAWLGPDGLWRLVVGTKDNHRGLAVLYRSRDFQSWAPAEGGPLHHGDTGM
WECPDFYPVGDGAQTKHVLKVSLDLTRFEYYTFGSYDHANDTYVPDAALADGERGLRYDY
GNFYASKTFLDTANKPRRVLWGWANESDSTADDVRKGWAGVQAIPRKLWLAPDGKQLMQW
PVAEVESLRGNHVNITDRLVEAGSYFEVQGLMIPAQADVEVSFAVVGGLDKAEPFDPAWR
GADAQTVCAARGADAEGGVGPFGLWVLASDQLKERTAVFFRVFNDDGKHVVLMCNDPSRS
SYADHLYKPTFAGFIDVDLAKTGGKIPLRTLIDHSMVESFGGHGKMSILSRVYPTQAVGD
KARLYVFNNGETDVKVTHLNAYDMRSAKISTEIDR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggcgattattcaggcgagaacgtgggtggttttcctgctgctcgcgcttctg
tcgccttcgtggcccgtcgccgaggcgtcgcaccacgtctcccccgacctgcagtccctc
gacgccggcctcgccgccgacgcgctccgcaccggctaccacttccagccccccatgcac
tggatcaacgatcctaatggcgtgatgtactacaagggcgtgtaccacctgttctaccag
tacaaccccaaggcggcggtgtggggcaacatcgtgtgggcgcacgccgtgtcgacggac
ctcgtgaactgggtcatgctggagccggccatctacccgacggcgcccttcgacgtcaac
ggctgctggtcgggctccgccaccgtgctccccgacggccggcccgccatcatgtacacc
ggcatcgacggcgacggccggcaggtgcagaacgtcgcgtacccgaaggacctctccgac
ccttacctccgtgagtgggtcaagccggactacaaccccgtcatcccccctggctccggg
gtgaacgccaccgcgttccgcgacccgaccacggcgtggctgggccccgacgggctctgg
cgcctcgtggtcggcaccaaggacaaccaccgcggcctcgccgtgctctaccgcagccgg
gacttccagagctgggcgcccgcagagggtggccctctgcaccacggcgacaccggcatg
tgggagtgcccggacttctaccccgtcggcgacggcgcccagaccaagcacgtgctcaag
gtgagcctcgacctgacgcggttcgagtactacacgttcggctcctacgaccacgccaat
gacacgtacgtccctgacgcggcgctggccgacggggaacgcgggctccggtacgactac
ggcaacttctacgcgtccaagacgttcctcgacacggcgaataagccgcggcgcgtgctg
tggggctgggccaacgagtccgactccacggccgacgacgtcaggaagggctgggccggc
gtgcaggccatcccgaggaagctctggctcgcgccggacggcaagcagctcatgcagtgg
cccgtggccgaggtcgagtccctccggggcaaccacgtcaacatcaccgacaggctcgtg
gaggccgggagttacttcgaggtccaggggctcatgatcccggcgcaggcggacgtggag
gtgtcgttcgcggtggttggcgggctggacaaggccgagccgttcgacccggcgtggcgc
ggggccgacgcgcagacggtgtgcgcggcgcggggcgcggacgcggagggcggcgtcggc
ccgttcgggctgtgggtgctcgcgtccgaccagctcaaggagaggacggccgtcttcttc
agggtattcaacgacgacggcaagcacgtcgtgctcatgtgcaacgacccttccaggtcg
tcatacgccgaccacctctacaagcccacttttgccggcttcatcgacgtcgacctcgcc
aagaccggcggcaagattcctctcagaaccttgatcgaccactccatggtggagagcttc
ggaggccacggcaagatgagcatcctgtcccgtgtgtacccgacgcaggccgtcggagac
aaggcgcgcctctacgtgttcaacaacggcgagacggacgtcaaggtcacgcacctcaat
gcctacgacatgcgctcggccaagatcagcacggagatcgatcgatga

DBGET integrated database retrieval system