KEGG   Brachypodium distachyon: 100838698Help
Entry
100838698         CDS       T01717                                 

Definition
(RefSeq) endoglucanase 8
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100838698
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     100838698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_9
Motif
Other DBs
NCBI-GeneID: 100838698
NCBI-ProteinID: XP_003570500
UniProt: I1IEK9
Position
3
AA seq 479 aa AA seqDB search
MFTGFSFDKAAAGAAVSFNYKDALSKSIMFLEAQRSGKLPPNNRIKWRGDSGMEDGKLAH
VDLTGGYYDAGDNVKYGLPLAFTVTTLAWTALAFKPELQAAGELNNVHAAIRWGTDYFLK
CAAKKNHMYVQVGDPNLDHQCWVRPENMNTPRTLYEIDDKTPGTEIAAETAAALAASSLV
FRDTDKGYSRRLLNKAKLLYQFGRSHMKTYDGECPFYCSYSGYNDELLWAATWLYMATKR
QAYADFISHEAISSSVAEFSWDLKYPGAQVLLADLNMTANGGLQSFKTQADNFVCAVLPD
TPFHQVFITPGGMIHLRDGANTQYVTGTAFLFVVYSDILLRSGQQVMCGSQPIPPARLKE
FAKQQIDYLLGANPRGRSYVVGFGVNPPTQPHHRGASTPVLKPGTVVNCGMSFGDWFAPD
RPNPNELTGAIMGGPDGNDEFVDKRNASSCTEPCTYINSLSIGPLAALAVRGNDLVASQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttcactggattttcgtttgataaggccgccgccggcgccgccgtgtcgttcaactac
aaggacgcgctgagcaagtccatcatgttcctggaggcgcagcgctccggcaagctgccg
cccaacaaccgaatcaaatggcgcggcgactccggcatggaggacggcaagctcgcccat
gtggacctgacgggcgggtactacgacgccggtgacaacgtgaagtacgggctgccgctg
gcgttcacggtgacgacgctggcgtggacggcgctggcgttcaagccggagctgcaggcg
gcgggggagctgaacaacgtgcacgcggccatccggtggggcaccgactacttcctcaag
tgcgccgccaagaagaaccacatgtacgtccaggtgggcgaccccaacctcgaccaccag
tgctgggtccgccccgagaacatgaacaccccgcgcaccctctacgagatcgacgacaag
acccccggcaccgagatcgccgccgagaccgccgccgcactcgccgcctcctccctcgtc
ttccgcgacaccgacaagggctactcccgccgcctcctcaacaaggccaagctcctgtac
cagttcgggcggagccacatgaagacctacgacggcgagtgccccttctactgctcctac
tccggctacaacgacgagctgctgtgggcggcgacgtggctatacatggcgacgaagcgg
caagcatacgcggacttcatcagccacgaggccatctcttccagcgtggccgagttcagc
tgggacctaaaatacccaggcgcgcaagtcctcctcgcggacctcaacatgacagccaac
ggcgggctccagagcttcaaaacccaagccgacaactttgtctgcgccgtgctcccggac
accccgttccaccaggtcttcatcaccccgggcggcatgatccacctccgggacggcgcc
aacacccagtacgtcaccggaacggccttcctcttcgtcgtctacagcgacatcctcctc
cggtccgggcagcaggtcatgtgcggcagccagccgatcccgccggcccggctcaaggag
ttcgccaagcagcagattgactatcttctgggggcgaatcccaggggaaggtcgtatgtc
gtgggcttcggggtgaacccgcccacgcagccgcaccacagaggcgcgtccacgccggtt
ctgaagcccgggaccgtggtgaactgcgggatgagcttcggggactggttcgcgcccgac
cggcctaacccgaacgagctcacgggcgccatcatgggcgggccggatgggaacgatgag
tttgtggataagcggaatgcgtcgtcgtgcacggagccttgcacttatattaactcgctt
tcgattggaccgctcgcggcgctcgctgtgcgcggcaatgatctcgttgctagccagtga

DBGET integrated database retrieval system