KEGG   Brachypodium distachyon: 100841413Help
Entry
100841413         CDS       T01717                                 

Definition
(RefSeq) coatomer subunit alpha-3
  KO
K05236  coatomer subunit alpha
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bdi04131]
    100841413
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdi04147]
    100841413
Membrane trafficking [BR:bdi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    100841413
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100841413
  Exosomal proteins of bladder cancer cells
   100841413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40 Fis1_TPR_C zinc_ribbon_9
Motif
Other DBs
NCBI-GeneID: 100841413
NCBI-ProteinID: XP_003564667
UniProt: I1HTL7
Position
2
AA seq 1219 aa AA seqDB search
MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH
KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW
NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKSASPADDIMR
LTQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE
VDTLRGHMNNVSCVLFHAKQDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHP
EMNLLAAGHDSGMIVFKLERERPAFSVSGDTVFYVKDRFLRFYEYSTQKEVQVAPIRRPG
SVSLNQSPRTLSHSPTENAVLICSDVDGGSYELYIVPKDSAGRADYLQDTKKGAGGSAVF
IARNRFAVLEKSSNQVLVKSLKNEIVKKTPVPIATDAIYYAGTGNVLCKAEDRVAIFDLQ
QRLVIGELQVSAVKYVVWSSDMESVALLSKHAVVIANKKLVHRCTLHETIRVKSGAWDEN
GVFIYSTLNHIKYCLPNGDSGIIRTVDVPIYITRVAGNNICSLDRDGKNKIIMVDASEYI
FKLALLRKRYDHVMSMIKSSQLCGQAVISYLQQKGFPEVALHFVKDEKTRFNLALESGNI
QIAVASAKELDDKDHWYRLGIEALRQGNVGIVEYAYQRTKNFDRLAFLYLLTGYLDKVGF
MSKIAGQNNNLMGQFHNALYLGDVRKRVEILESAGQVPLAYVTAATHGLTEIADRLASEL
GENVPSLPEGKGRSLLIPPAPLTACGDWPLLRVMRGIFEGGLDATGRAEQDEDYEDAGGD
WGDEDLEIVDVSNVVENGDITVHVEENGTNEEDGEEEGGWDLEDLELPPEAETPKATGPS
RSALFVVPTPGMPVSQIWTQKSSLAGEHAAAGNYDTAMRLLSRQLGIRNFAPLKALFLDA
HMGSHTFLRAFASAPVIPVAVEKGWSESASPNVRGPPALVFSFSQMDDKLKAAYKATTEG
KFPEALRQFLNILYTIPLLVVDSRREVDEVKELIEIVREYVLGLKMEVKRKELKDDATRQ
QELAAYFTNCKLQKVHMRLVLTSAMGLCFKGGNYATAANFARMLLENSPNEAQAKKARQV
LQACGDRKDGHQLNYDFRNPFVVCGATFVPIYRGQKDVSCPYCASRFVPSVEGQLCSICE
LSVVGADASGLLCSPTQSR
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccaagttcgagaccaagagcaaccgcgtcaagggcctcgccttccacccgcgc
cgcccatggatcctcgccagtctccacagcggggtcgtccagatgtgggactaccgcatg
ggcacgctcctcgaccgcttcgacgagcacgacgggcccgtacgcggtgtccacttccac
aagacgcagccgctcttcgtatctggaggtgatgattacaagattaaggtgtggaactac
aagacacaccgctgcctcttcacgctccatggtcaccttgattacatccgcactgtccag
ttccatgacgagcatccatggatcgtgagtgctagcgatgaccagacaatccgtatttgg
aattggcagtcacgtacatgtgtggcggtgttgacagggcataatcactatgtcatgtgt
gcttccttccatcccaaggaggacctggtcgtgtcagcatctctggatcagactgtccgc
gtgtgggatattggggcactcaggaagaagtcggcctccccagcggatgacattatgcgt
ctcacgcagatgaacactgatctgtttggaggcattgatgctgttgtcaagtatgtcttg
gagggtcatgaccgtggggtcaattgggcttcatttcatcccacactgccacttatcgtt
tctggggcagatgaccggcaagtgaaactgtggagaatgaatgatacaaaggcgtgggag
gttgatactctgaggggtcacatgaataatgtgtcatgtgtattgttccacgcgaagcaa
gacatcatcgtatccaactcggaagacaaaagcattcgcgtgtgggatgcaacgaagaga
actggtatccagacattcaggcgagagcatgaccgcttctggatccttgctgctcaccct
gaaatgaatcttcttgccgctggtcatgatagtggcatgattgtgtttaagttggagagg
gaacgccctgctttctccgtaagtggcgatacagtgttctatgtgaaggatcgcttcctc
cgtttctatgagtactcgacacagaaagaggtccaggtggctccgataagaaggcctgga
tcagtcagcttgaatcagtcaccaaggacgttgtcacacagcccaactgagaatgctgtc
ttgatctgctctgatgtggatgggggctcatacgagctttatattgttccaaaggactct
gctggtagggctgattacttgcaggacacgaagaaaggagctggtggttctgcagttttc
atagcacgcaaccggtttgcagtcttggagaagagcagcaaccaggttttggtgaagagt
cttaagaatgagattgtgaagaaaactccagtacctattgcaactgacgctatttactat
gctggaactggtaacgtattgtgcaaagccgaagacagggtggccatctttgatctgcag
cagcggcttgttattggtgaactccaggtatctgctgttaagtatgtggtttggtccagt
gatatggagtctgttgcattgctcagcaagcatgccgtagtcattgcaaacaagaagctt
gtccatcgctgcacacttcatgaaaccatacgtgtaaagagtggtgcctgggatgaaaat
ggtgtgttcatatattccactctgaaccatatcaagtattgccttcctaatggggacagt
ggtattatcagaactgttgatgttcctatttacataaccagagttgcggggaacaacatt
tgctctctggatcgtgatggaaagaacaagataattatggttgatgcatctgaatacatt
ttcaagctggcccttctacggaaacgctacgatcatgttatgagcatgatcaagagctcg
cagctgtgtgggcaagcggtcatttcttacctgcaacagaaagggtttccagaagttgct
ctacactttgtgaaagatgagaaaaccagatttaacctggctcttgagagcgggaacatt
caaattgctgttgcttcagcaaaagagcttgatgacaaggatcactggtacaggttggga
attgaggctctgagacagggaaatgttggtattgttgaatatgcataccagagaacaaag
aattttgacaggcttgcttttctttatctgctaactggttacttggacaaggtgggcttt
atgtctaagatagctggacagaacaacaatttgatgggccagtttcacaatgcattgtat
cttggggatgttaggaaaagagttgagatattggagagtgctggacaggtacctcttgcc
tatgtaactgcagccactcatgggctcactgaaattgccgataggcttgctagtgaattg
ggagaaaatgtgccttctctgcctgaaggaaaaggtagatcacttttaattcctcccgca
cctctcacggcttgtggtgattggccattgttgagggtgatgcgaggtatttttgagggt
ggactagatgctactggtagggcagagcaggatgaagactatgaagatgctggtggtgac
tggggggatgaagaccttgaaattgttgatgtaagtaatgtggttgaaaatggagatata
actgtccatgttgaggaaaatgggacaaatgaagaggatggagaagaggaaggtggctgg
gaccttgaggacctggaattaccacctgaggcagagacaccaaaagctacaggtccgtcc
cgttctgctttgtttgtggttcctacaccaggcatgcctgtcagccaaatttggactcag
aaatcatctcttgctggagagcatgctgcagctgggaattatgacactgcaatgcgattg
cttagccgccagttgggcataaggaactttgctcctctgaaagccttgtttcttgatgca
catatgggcagtcatacctttctgcgtgcatttgcaagtgctccagttatacctgttgct
gttgagaagggctggagtgaatctgctagtcccaatgtgaggggcccacctgcactcgtg
tttagcttctcacaaatggacgacaagcttaaggctgcatataaagccacaaccgagggt
aaattcccagaagcactgaggcagtttcttaacatcctctacaccattccactccttgtt
gtggactcgcggagagaagttgatgaagtgaaggagctcattgagatagtgagagaatat
gttcttggtcttaagatggaagtcaaaaggaaggagctgaaagatgacgcgacacgccaa
caggagttggctgcatacttcactaactgcaagctgcagaaggttcatatgcgtcttgtc
ctcaccagtgccatgggtctttgcttcaagggtggaaactacgccacggcagcgaacttt
gcgcgaatgcttctggagaacagcccaaatgaggcccaggcaaagaaggctcggcaagtt
ctgcaggcttgcggtgacaggaaagatgggcatcagctgaactatgacttcagaaatcca
tttgttgtgtgtggagcaacctttgttccaatataccgtgggcagaaggatgtttcctgc
ccatattgtgcgtctcggtttgtgccctccgtagaaggtcagctttgcagcatatgtgag
ctttcggtggttggagcagatgcttcaggactcctatgctctcctacacaatcgagatga

DBGET integrated database retrieval system